KEGG   Alteromonas sp. Mac2: AV940_03110Help
Entry
AV940_03110       CDS       T05899                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
alz  Alteromonas sp. Mac2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 HI0933_like Pyr_redox Pyr_redox_3 3HCDH_N AdoHcyase_NAD FAD_oxidored FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMJ89549
LinkDB All DBs
Position
complement(745150..746175)
Genome map
AA seq 341 aa AA seqDB search
MFAAQYAGEKTFNIQPGTTVPPGPGEVRLSVGYVGICGTDMHIYHGVMDARVAPPQIIGH
EMSGVVAEVGEGVKNVVIGDHVVVRPLDYCLNCPACDAGHSHVCQNLKFMGIDTPGAFQS
SWTVKSRTLHKLPSNVSLKMGALVEPLAVACHDVARARVAKGEDVVVIGGGPIGQLVAMV
AKAKGANVIISEVNATRRQFSEDNGINTIDPINQDPVAEIAKVTNGKGADVVFEVSGVQP
AVDVMTEIAAVRGRICMVAIHSQKPQVDLFKFFWKELELLGARVYEHEDFEQAIKLIADG
SLDLEPLISSVSKINDIGSAFASMDGNPSGMKALVSLSEEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagcacaatacgcaggtgaaaaaacctttaacattcaacctggaaccacagtt
ccaccaggacccggagaagttcgactttcagttggttatgttggaatttgtggtacagac
atgcatatatatcacggcgtgatggacgcacgtgttgcccctccccaaattataggtcat
gaaatgtcaggggtggtagccgaggtaggtgaaggcgtaaaaaatgtggttataggtgac
catgtcgttgtccgcccgcttgattattgcctgaattgccccgcttgtgatgcgggtcat
tcacacgtttgccaaaaccttaaatttatgggtattgatactcctggtgcattccaaagt
tcatggacagtgaaatcacgcacgttgcataaacttcctagtaatgtttctttaaaaatg
ggcgcccttgttgagcctcttgcagtggcttgtcacgatgttgctagagcacgtgttgca
aaaggtgaggacgttgtggttattggcggtggccctatcggtcaactcgttgcaatggta
gctaaagctaaaggggcgaatgtcatcatctctgaagttaatgccactcggagacaattt
tcagaagataatggtattaatacgattgatccaataaaccaagacccggttgccgaaatc
gcgaaagtgactaacggaaaaggcgcagatgtggtctttgaagtttcaggcgttcagcca
gccgttgacgtgatgacagaaatcgcggcagtgcgtggtcgcatttgcatggtggccatc
cactcacaaaaacctcaggtcgatctcttcaagttcttttggaaagaattagaactgcta
ggtgctcgggtatatgagcatgaagactttgagcaagcgattaagctaattgcagatggc
tcactagatcttgagccgcttatcagctcggtaagcaaaatcaatgatattggtagtgct
tttgcttctatggatggtaacccttctggtatgaaagcactcgtgtcgttaagtgaggaa
ttctaa

DBGET integrated database retrieval system