KEGG   Alteromonas sp. Mac2: AV940_03110
Entry
AV940_03110       CDS       T05899                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AV940_03110
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AV940_03110
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AV940_03110
    1.1.1.-  
     AV940_03110
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 HI0933_like Pyr_redox DAO Pyr_redox_3 3HCDH_N AdoHcyase_NAD FAD_oxidored FAD_binding_3
Other DBs
NCBI-ProteinID: AMJ89549
LinkDB
Position
complement(745150..746175)
AA seq 341 aa
MFAAQYAGEKTFNIQPGTTVPPGPGEVRLSVGYVGICGTDMHIYHGVMDARVAPPQIIGH
EMSGVVAEVGEGVKNVVIGDHVVVRPLDYCLNCPACDAGHSHVCQNLKFMGIDTPGAFQS
SWTVKSRTLHKLPSNVSLKMGALVEPLAVACHDVARARVAKGEDVVVIGGGPIGQLVAMV
AKAKGANVIISEVNATRRQFSEDNGINTIDPINQDPVAEIAKVTNGKGADVVFEVSGVQP
AVDVMTEIAAVRGRICMVAIHSQKPQVDLFKFFWKELELLGARVYEHEDFEQAIKLIADG
SLDLEPLISSVSKINDIGSAFASMDGNPSGMKALVSLSEEF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtttgcagcacaatacgcaggtgaaaaaacctttaacattcaacctggaaccacagtt
ccaccaggacccggagaagttcgactttcagttggttatgttggaatttgtggtacagac
atgcatatatatcacggcgtgatggacgcacgtgttgcccctccccaaattataggtcat
gaaatgtcaggggtggtagccgaggtaggtgaaggcgtaaaaaatgtggttataggtgac
catgtcgttgtccgcccgcttgattattgcctgaattgccccgcttgtgatgcgggtcat
tcacacgtttgccaaaaccttaaatttatgggtattgatactcctggtgcattccaaagt
tcatggacagtgaaatcacgcacgttgcataaacttcctagtaatgtttctttaaaaatg
ggcgcccttgttgagcctcttgcagtggcttgtcacgatgttgctagagcacgtgttgca
aaaggtgaggacgttgtggttattggcggtggccctatcggtcaactcgttgcaatggta
gctaaagctaaaggggcgaatgtcatcatctctgaagttaatgccactcggagacaattt
tcagaagataatggtattaatacgattgatccaataaaccaagacccggttgccgaaatc
gcgaaagtgactaacggaaaaggcgcagatgtggtctttgaagtttcaggcgttcagcca
gccgttgacgtgatgacagaaatcgcggcagtgcgtggtcgcatttgcatggtggccatc
cactcacaaaaacctcaggtcgatctcttcaagttcttttggaaagaattagaactgcta
ggtgctcgggtatatgagcatgaagactttgagcaagcgattaagctaattgcagatggc
tcactagatcttgagccgcttatcagctcggtaagcaaaatcaatgatattggtagtgct
tttgcttctatggatggtaacccttctggtatgaaagcactcgtgtcgttaagtgaggaa
ttctaa

DBGET integrated database retrieval system