KEGG   Alteromonas sp. Mac2: AV940_08845Help
Entry
AV940_08845       CDS       T05899                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00071  Fatty acid degradation
alz00280  Valine, leucine and isoleucine degradation
alz00281  Geraniol degradation
alz00310  Lysine degradation
alz00362  Benzoate degradation
alz00380  Tryptophan metabolism
alz00410  beta-Alanine metabolism
alz00640  Propanoate metabolism
alz00650  Butanoate metabolism
alz00903  Limonene and pinene degradation
alz00930  Caprolactam degradation
alz01100  Metabolic pathways
alz01110  Biosynthesis of secondary metabolites
alz01120  Microbial metabolism in diverse environments
alz01130  Biosynthesis of antibiotics
alz01200  Carbon metabolism
alz01212  Fatty acid metabolism
Module
alz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AV940_08845 (fadJ)
   00650 Butanoate metabolism
    AV940_08845 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AV940_08845 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AV940_08845 (fadJ)
   00310 Lysine degradation
    AV940_08845 (fadJ)
   00380 Tryptophan metabolism
    AV940_08845 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AV940_08845 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AV940_08845 (fadJ)
   00281 Geraniol degradation
    AV940_08845 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AV940_08845 (fadJ)
   00930 Caprolactam degradation
    AV940_08845 (fadJ)
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AV940_08845 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AV940_08845 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AV940_08845 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AMJ90572
LinkDB All DBs
Position
complement(2107861..2109999)
Genome map
AA seq 712 aa AA seqDB search
MTNDVQATSGAFTLTKQDNGVAILTMDVPGESMNTLKAAFGDEISAMLDDIDADTSIKGV
VLTSGKANSFVAGADISMLAACNTAEDATTIAAGGQAIFDRIERMKATFVAAINGPALGG
GLELALACHYRICTDSPSTQVGLPEVQLGLLPGSGGTQRLPRLIGIQQAMKMMLTGAPAR
AKQAKKYGIVDDVVPQSVLLKVAEQFALKRKPEREAPQKSVMDKMLENTGPGRGMMFKKA
REATFAKTKGNYPAPGYIIDVIETGMRDGIEAGLKAEAEAFGKLVMTPESFQLRQIFFAT
TDMKKENGIEGVAPEKMKKVGVLGGGLMGGGIAFVTSTKAGVPVRIKDVRPEGIANAMKY
SYDILNKKVKKRFMRSSEMQKQLSLITGTLDYSGYQDTDIVVEAVFEDLDLKQKMVADIE
ENCKENTIFASNTSSIPITQIAAKAARPENVIGLHYFSPVDKMPLAEVIAHETTSDQVIS
STVEFAKKQGKTPVVVKDGAGFYVNRILAPYMNEAASLILAGEPIEHIDKSLVKFGFPVG
PVKLLDEVGIDVGTKIIPFLVEAFGERFTAPSAFDKVLADGRKGKKNQKGFYSYEGKKPG
KEVDESIYSLLGLTPSTKLSEKEVAERCVLMMLNEAARCLDESVIRNARDGDIGAIFGIG
FPPFLGGPFRYMDTLGVKHVVERLNHYASTVGDKFAPADVLVKMAEENSSFY
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgacgttcaagcaacatctggtgcctttacgttaaccaaacaagacaatggc
gtagccatactcaccatggatgtacctggtgagtctatgaatacgctaaaagcagctttt
ggcgatgaaatatctgccatgctggatgacattgatgcagataccagtattaaaggtgtt
gtgctaacgagtggcaaagcaaactcgtttgtagccggcgcggatattagcatgcttgct
gcgtgtaataccgcagaagacgcgacgacgattgcagcaggcggccaagctatttttgac
cgtatcgaacgcatgaaagcaacttttgttgcagccataaatggccctgcgctcggtggt
ggtttagagcttgcccttgcgtgtcattatcgaatttgtaccgattcaccaagcactcag
gtgggtttgcccgaagttcagcttggcttattgcctggcagtggtggcacacaacgatta
cctcgtttgattggtatacagcaagctatgaaaatgatgcttactggtgcgccagcacgc
gcgaagcaagctaaaaagtacggcattgttgatgatgtagtaccgcaaagcgttttgctt
aaagtggctgaacagtttgcccttaagcgcaagcctgagcgtgaagcgccgcaaaaaagc
gtaatggacaaaatgcttgaaaataccggcccaggccgtggcatgatgttcaaaaaagcg
cgcgaagcgacgtttgcaaaaacgaaaggtaactatcctgcgcccggttacatcattgat
gttatcgaaactggcatgcgtgatggcattgaagctggtcttaaagccgaagctgaagca
ttcggaaagttggtgatgacgcctgaatctttccagttacgccaaattttcttcgcgact
accgacatgaagaaagaaaacggtattgaaggcgtagcgccagagaaaatgaagaaagtt
ggcgtactaggcgggggattaatgggcggcggtattgcgtttgtaacctctactaaagct
ggcgtacctgtgcgtattaaagatgttcgccctgaaggcattgctaatgcaatgaaatat
agctacgacattttaaataagaaagtgaaaaagcgcttcatgcgtagtagcgaaatgcaa
aagcaactgtcgcttatcactggcaccttagactatagcggctatcaagataccgatatt
gtagttgaagcggtatttgaagatttagatcttaagcaaaaaatggttgcggatattgaa
gaaaattgcaaagagaacactatctttgcctctaacacttcttctattccaattacccaa
attgctgccaaagctgctcgtcctgaaaacgtgattggtcttcactacttttcacctgta
gataaaatgccattggcggaagttatcgctcatgaaactacgtcggatcaagttatttca
tctactgttgaatttgcgaaaaagcagggtaaaacacccgtcgttgttaaagatggcgca
ggcttttacgttaaccgcattttagcaccttacatgaatgaagcggctagcttaattctt
gcaggcgagcctatcgagcacatcgacaagtctctcgttaagtttggcttccctgtaggt
cctgtgaagttgcttgatgaggttggcattgatgttggtactaagatcattcctttccta
gtagaagcctttggagagcgttttacggcgccatctgctttcgataaagtactggctgat
ggtcgtaaaggtaaaaagaaccaaaaaggtttttacagctacgaaggcaagaagccaggt
aaagaagtggatgaaagtatctactcacttctgggtttaacaccgtcaactaaattgagt
gaaaaagaagtggctgaacgctgcgtgcttatgatgcttaatgaagccgctcgctgttta
gatgagagtgttattcgcaatgcccgtgatggcgacattggtgctatctttggcatcgga
tttccacctttcctaggcggtcctttccgttatatggacacgttgggagtaaaacatgtt
gttgagcgcttgaatcattacgctagcaccgtgggtgataaattcgcacctgctgatgta
ttggtgaagatggctgaagagaacagttccttttattaa

DBGET integrated database retrieval system