KEGG   Alteromonas sp. Mac2: AV940_10400Help
Entry
AV940_10400       CDS       T05899                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00020  Citrate cycle (TCA cycle)
alz00190  Oxidative phosphorylation
alz00650  Butanoate metabolism
alz01100  Metabolic pathways
alz01110  Biosynthesis of secondary metabolites
alz01120  Microbial metabolism in diverse environments
alz01130  Biosynthesis of antibiotics
alz01200  Carbon metabolism
Module
alz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
alz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AV940_10400 (sdhB)
   00650 Butanoate metabolism
    AV940_10400 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AV940_10400 (sdhB)
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AV940_10400 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AV940_10400 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AMJ90846
LinkDB All DBs
Position
complement(2464833..2465543)
Genome map
AA seq 236 aa AA seqDB search
MQLQFSIYRYNPDVDNKPRMQDYTLEVEEGRDMMVLDALIALKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGKGKVVVRPLPGLPVVRDLVVDMTQFYTQYEKIKPFLI
NDDKQPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATDERLNDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacaattttcgatatatcgttacaaccctgatgttgataacaagccacgcatg
caagactacactctagaagtagaggaaggtcgtgacatgatggtgttggatgcacttatt
gctcttaaagagcaagatccaacgttatcattccgccgctcgtgccgtgaaggtgtgtgt
ggttcagacggtgtcaatatgaatggtaagaatggtcttgcctgcattacgccattgtct
gcattaggtaaaggtaaagttgttgttcgtccacttccaggtttgccagtagtacgcgac
cttgtggttgatatgacacaattttacacccagtatgaaaagattaagccattcttaatc
aacgatgataaacagcctcctgcaagagaacaccttcagtctcctgaagaacgtgctaag
cttgatgggctgtatgaatgtattctatgtgcatgttgttctacgtcgtgcccatcgttc
tggtggaacccggataaatttatcgggccagctggtttgcttcacgcttatcgtttcctt
atcgatagtcgtgatactgcaaccgacgaacgcttgaacgacctagatgacgcatttagc
gtattccgctgtcacggtatcatgaactgtgtaagtgtatgtccgaaaggattaaacccg
acaaaggcaattggacacattaagtctatgcttttacaacgggctgtttag

DBGET integrated database retrieval system