KEGG   Alteromonas sp. Mac2: AV940_10875Help
Entry
AV940_10875       CDS       T05899                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alz  Alteromonas sp. Mac2
Brite
KEGG Orthology (KO) [BR:alz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AV940_10875
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AV940_10875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 FAD_binding_2 GIDA DAO Thi4 FAD_oxidored Lycopene_cycl NAD_binding_8 NAD_binding_7 AlaDh_PNT_C FAD_binding_3 K_oxygenase Thioredoxin_9 3HCDH_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMJ90927
LinkDB All DBs
Position
complement(2580541..2582130)
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKGYAESMQKNVTFVVQTGEHSKREELVSFLSDIAGVSDKLSLEERDTNGV
LRSSISFLLEADGEDTGIRFSGIPGGHEFNSLILGMLHASGTELKIDDSVKAIVKGVKEE
LNFEVFISLSCHNCPEVVQALNQFALLNPNITSEMIDGGLYQNVVAERDIQGVPSVYLNG
ELFANGKVDASVLIDKLIERDPSLKDANKGESLPLQDVTVIGGGPAGVASAIYSARKGLK
VTVVADRFGGQVKDTMGIENLISVSKTTGPELVGNLMEHMNDYDITLKEHVRVDSVEQGN
VKTITLSSGEQIRTRSIVVATGARWRELGVPGEKENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPQLKADQVLIDQAEKRENITIIRNAATHQITAEN
GKVNAIEYQDRNTNELHTLPLSGVFVQIGLVPNSQFMEGVVDMSKYGEIVIDTKCNTSAP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVIEMEEETQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcgttgaaaggctatgctgagtcaatgcagaaaaac
gtaaccttcgtcgtacagaccggtgaacacagcaagcgtgaagagcttgtgtcgtttctg
tccgacattgctggtgtaagtgacaaattaagccttgaagagcgtgacaccaacggtgta
ttacgcagctctatcagctttcttttagaagctgatggcgaagatacaggcattcgtttt
tctggtattcctggcggccacgaatttaactcgcttatcttaggtatgcttcacgcatca
ggtaccgagcttaaaattgatgacagcgtaaaagcgattgttaaaggcgttaaagaagaa
cttaacttcgaagtatttatcagtctaagctgccacaactgcccagaagtggttcaggcg
cttaaccaatttgcgctacttaatccaaacattacgtctgaaatgattgacggtggtttg
tatcaaaacgtagttgcagaacgtgacattcaaggtgtcccaagtgtttaccttaatggc
gagttgttcgctaacggtaaggtagatgcatcggtgcttatcgacaaacttatcgaacgt
gacccttcgctaaaagatgcgaacaagggggagtcgttaccgctacaagacgttaccgta
attggtggtggtccagctggtgtggcttcagcgatatacagcgcacgtaaaggcttaaaa
gtgactgtggttgccgatcgtttcggtggtcaggtgaaagatactatgggtattgagaac
cttatctcagtatctaaaactaccggccctgagctagtaggtaacttgatggaacacatg
aacgattacgatatcacgcttaaagagcacgttcgtgttgattctgtagaacaaggtaat
gttaaaacgatcacgttatcgtctggcgaacaaattcgcacccgttcaattgttgtggcc
actggcgcacgctggagagagttgggtgtcccaggtgagaaagagaacgttggtaatggc
gttgcgtactgcccacactgcgatggtcctttcttcaaaggtaaagacgttgcggtaatt
ggtggtggtaactcgggtattgaagcggcgcttgatttggcgggtattgtgaaatcggta
acggtattcgaattcatgccacaacttaaggctgaccaagtactgattgaccaagctgaa
aaacgtgaaaatatcacgattatcagaaatgctgctacgcatcagattaccgctgaaaac
ggcaaggtgaacgctattgagtatcaagatcgcaataccaacgaattacacacgcttcca
ctatcaggggtattcgtacaaattggtttagtgccaaacagccaattcatggaaggtgta
gtagacatgagtaagtacggcgagattgtgattgatacgaaatgtaatacgtcagcacca
ggcatctttgcggcgggcgacgtaacaacagtaccttataagcaaatcgttatctcaatg
ggcgagggtgcaaaagcatcactggcagcatttgaatacttgctaagccatgaagtaatt
gaaatggaagaagaaacacaagctgcgtaa

DBGET integrated database retrieval system