KEGG   Alteromonas sp. Mac2: AV940_18370Help
Entry
AV940_18370       CDS       T05899                                 

Definition
(GenBank) hypothetical protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
alz  Alteromonas sp. Mac2
Pathway
alz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:alz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AV940_18370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:alz02000]
    AV940_18370
Transporters [BR:alz02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    AV940_18370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 SbcCD_C
Motif
Other DBs
NCBI-ProteinID: AMJ92274
LinkDB All DBs
Position
complement(4390085..4391962)
Genome map
AA seq 625 aa AA seqDB search
MKSKPLQPAVSAQGIAASKASSSLTEQTSIAAYGALGLALLHGIAGLSILIISSWFIAIS
AIAPLGFNYVIPAVVIRGLALLRIASGYTTMWLGHKDLLTRIAKARLAVFEQLAAKRLES
KAWTVEALANHTEQLASAFIAWVSPLASVMLLMTGLLLTGYFMNVPGYGFFIALAIVWLV
ISVVTAVYGLKAVASSAEAELEFRQHSATFFQASSLWHLKSKTVKGLFNAPSTQRVQDAQ
LKEQALVSKAMWLFQGGVFTLVALVVFTANTAAYFVPLALITPMVLLAAPDWASATFSSV
VKFAKWRHSKAELEAMHTQPLPLLNAHKPSMSLSLTGFIAKERNLPAVNMQFAALGLNVI
KGYSGCGKSSVLQAICGLLPFEGRRSIDNVATPQGMLEKWLYVEQQPIILAGTIKLNLDP
AASGISEDAMHNVLARVGLQHLTTLAEWVGKGGRALSGGEGKRLALARALLAMPDVLLID
EPFEGLDYEAQQRVAEVINESAHSRLVIVATHVVPAALQPNTTFSLDEKGYQSKSHPSLH
TQLNGTQLSYSQLSHNQPRYNQPRYNQLSHTQIDHAHQNTVGEGGWQVTSPNCTTLTPSE
QQQQALAELQHHERNTAFGFKPRRK
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaaaccgttacagcctgctgtatctgcgcaaggtatagctgcatcaaaagcg
tcttcgtcactcaccgagcagacgtcaatagcagcgtatggagcgctgggcttagccttg
cttcatggtatagcgggtttgagtattcttatcatttcatcttggtttattgccattagc
gcaatagcccctttagggtttaactacgtgatccctgcggtggtgattcgtgggctcgca
ctacttcgtatcgcttctggttacaccaccatgtggctaggacacaaggatttattaacc
cgaattgccaaagcacggttagctgtgtttgagcaattagcggcaaaacgccttgaaagc
aaagcatggacagttgaagcgctcgcgaaccacactgagcaacttgcctcagcttttatt
gcgtgggtttctccattagcctcggttatgctgctaatgacaggcttgttgctcacgggg
tatttcatgaatgtgccaggttatggttttttcatagccctagccatagtgtggttggta
attagtgttgttactgcggtttacggactgaaagccgtggctagttcggctgaggcagag
cttgaatttcggcaacacagcgcgacgttttttcaagcaagtagtttatggcaccttaag
tcaaaaacggtaaagggcttgtttaatgcaccctctactcagcgcgtacaagatgcacaa
ctaaaagagcaggcattagtgtctaaagctatgtggctgttccaaggtggcgtgttcact
ttagtggcgctggttgtttttactgccaatacggcagcctattttgttccgctagcactc
attacgccaatggtgctattggctgcaccggactgggcgagcgccactttcagcagtgtc
gtgaagttcgctaagtggcgacatagcaaggcagagctagaagcaatgcacacccagcct
ttgcccttactaaatgcccataaacccagcatgtcactttctttaacgggttttatcgct
aaagaaagaaacctaccagcggtcaatatgcagtttgcggcgttagggctgaatgtgatt
aaaggctattcggggtgcggtaagtcgagcgtactacaagcaatatgcgggctccttcct
tttgaaggtcgacgctctatagacaatgttgccacgccgcaaggcatgctagaaaaatgg
ctttatgttgaacagcaacccatcattttggccggtactattaaactcaatttagatccg
gcagcgtctggaataagcgaagatgccatgcataatgttttagcccgggttggtttgcag
caccttactaccttggctgaatgggttggtaaaggaggaagggcgttatctggcggtgaa
ggtaagcgtttagcattggccagagccttactagcgatgcccgatgtgttgttaattgat
gaaccttttgaagggctagactacgaagcacagcagcgcgtcgccgaggtcattaatgaa
agtgcgcattcgcggttagtcattgttgctacccatgttgttcctgcggcccttcaacct
aatacaaccttctcgcttgatgaaaaaggttatcagagtaaatctcaccccagccttcat
actcaactaaatggcacccagctaagttatagccaactaagtcataaccaaccaagatac
aaccaaccaagatacaaccaactaagccatacccaaatagatcatgcccaccaaaacacg
gttggcgaaggtggatggcaggtaacttcgccgaattgcacgacgctaacgcctagtgaa
cagcagcaacaggctttggcagagctgcaacaccacgagcgcaacacggcttttggtttt
aagccgcgaaggaaataa

DBGET integrated database retrieval system