KEGG   Anaplasma marginale St. Maries: AM024Help
Entry
AM024             CDS       T00216                                 

Gene name
maeB
Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00620  Pyruvate metabolism
ama01100  Metabolic pathways
ama01120  Microbial metabolism in diverse environments
ama01200  Carbon metabolism
Module
ama_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AM024 (maeB)
Enzymes [BR:ama01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     AM024 (maeB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M GP57 AlaDh_PNT_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AAV86208
LinkDB All DBs
Position
16020..18272
Genome map
AA seq 750 aa AA seqDB search
MGDFSERDREALEFHCKRRPGKVSLLPTKPLMTQGDLSLAYSPGVAVPCLRIASDPDTVY
DYTARGNYVAVISNGTAVLGLGNIGPLASKPVMEGKAVLFKRFADIDAVDIEVDTEDVEE
FINAVKHLGLSWGGINLEDIRAPECFIIERRLGELMDIPVFHDDQHGTAIITLAGIINAL
DITGRNLKSVKIVVNGAGAAGIACVEMLKFVGIPNDNIVLCDQNGVIYKGRQLGMNEWKL
KHAIETKERDLKDAMKGADIFIGLSVRDVLSKEMLLSMNKDPVIFALANPYPEVNPEFAR
EVRPDAIIATGRSDYSNQINNVMGFPYIFRGALDVRAKSVNNEMKLAAAEALAMLAREVV
SDEVLEAYGGRGMGYGKEYIIPTPFDPRLLSVVSPAVAKAAINSGVARKKIDDWDRYALE
LNSRISPTSNILNLMYGSVKSSPKRVIFPEGEEVRVIKAALQWYGQGYGTPILVGRVDKI
KESLDLIGVDSLEGITIANAAISSRNDVYIDYLYSKLQRMGRLHRSCVRDVKTDRNVFAA
CMLACGDGDTLVTGITRGYSESLSDIRKVIDARGEVFGLSVVVMEERTLFIADTAINELP
TAQQLADIAIKSAAAARSMGHEPRVAFVSFANFGSHSQKESDRVRQCMDIVASRNVDFEY
DGEMSVDVALKPESLSMYPFCRLSKPANVLIMPSLYSASISSKLLREVGGTTVVGPILMG
MEKPVQIVQMTASVSEILNLAVLATLSHPI
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatttttcagaaagagatagggaggcgctcgaatttcactgcaaaaggaggccg
ggtaaggtttccttgttgcctactaagccacttatgacgcagggtgacctttcgctggct
tattccccaggcgtcgccgtgccatgcctgagaatcgcctccgatcctgacacagtgtat
gactacaccgccaggggtaactatgttgctgtgatctccaacggtaccgcagttttgggg
ttgggcaacataggccctcttgcatccaagccagttatggaaggtaaggcagttttgttc
aagcggtttgctgatattgacgctgttgatatagaagtcgacacagaagacgtagaagag
ttcataaatgccgtgaagcatctcggcctcagttggggcggcataaatttggaggatata
cgcgctcctgagtgcttcatcatcgagaggcgccttggcgagctgatggatattcccgta
ttccatgatgaccagcatggcactgccattataacactcgccggaatcataaacgcgctg
gacatcactgggagaaatctcaagagtgttaagatagtcgtgaatggcgcgggcgccgcg
ggcatagcgtgcgtagaaatgctaaagtttgtgggcatccccaacgataacatagtgctg
tgtgaccaaaatggggtgatatacaaagggcggcagctcgggatgaacgagtggaagctc
aagcacgcgatcgagactaaagagagagatttgaaagacgccatgaagggggcggatatc
tttatcggactgtctgtgcgcgacgttttgagcaaggaaatgctgctctccatgaacaaa
gacccagtgatttttgcgttggcaaacccatatccggaagtaaacccagagtttgcgcgg
gaggtgcgcccagatgccataatagccactggccgctcagattacagcaaccaaatcaac
aacgtaatgggctttccctacatattccgcggggctttagatgtgcgggcaaagtctgta
aacaatgaaatgaaactagctgcggctgaggctttggctatgttggcaagagaagtggtc
agtgatgaggttttggaggcctatggcgggcgcggaatgggctatggcaaggaatacata
attccaactccgtttgaccccagattgctgtccgtggtctctcccgcagttgcgaaggcc
gccataaactccggagttgcaagaaaaaaaattgacgattgggaccgctacgctctggaa
ttgaactccaggatttcacccacctctaacattttgaacctcatgtatggttcagtaaag
agctctccaaagcgcgtgatcttccctgaaggcgaggaagtacgagtaattaaggccgcg
ctgcagtggtacgggcaaggttacggtacgcccatactggtgggaagggttgataagatc
aaagaaagccttgacctgataggggtagattccctcgagggtattaccatcgcaaacgct
gcgatttcctctcgcaatgacgtatacatagactacctgtacagtaaacttcagcgtatg
gggcgcttgcaccgcagctgcgtcagggacgtcaagacggacagaaacgtttttgccgca
tgtatgctcgcatgtggcgatggggatactttagtcacgggtataactcgaggatacagc
gagtcactctcagacattcgcaaggtaatcgacgcgcgaggggaggtatttggcctgtca
gttgtggtcatggaggagcgcacgctattcattgctgatacagccataaacgaacttccc
accgcgcaacaactggccgatatagcaattaaatctgccgcggccgcgcggagtatgggg
catgaacccagggttgcttttgtctcattcgcaaatttcggcagtcactctcaaaaggaa
tctgatcgggtgcggcagtgtatggacattgttgcaagccgtaacgtagattttgagtat
gatggtgaaatgtcggtagatgttgcgctgaagcccgaatcgctgtctatgtaccccttt
tgtaggttgagcaaacctgcaaatgttctgataatgcccagcctatacagcgcgagcata
tcttctaagttgttgcgagaagttggcgggacgaccgttgttgggccaattctcatgggc
atggagaagccggtgcagatcgttcagatgaccgcttcggtgtcggagattctcaacctt
gcagtcctcgccacgctttcgcaccccatctag

DBGET integrated database retrieval system