KEGG   Anaplasma marginale St. Maries: AM1098Help
Entry
AM1098            CDS       T00216                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00061  Fatty acid biosynthesis
ama00780  Biotin metabolism
ama01100  Metabolic pathways
ama01212  Fatty acid metabolism
Module
ama_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AM1098 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AM1098 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ama01004]
    AM1098 (fabZ)
Enzymes [BR:ama01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AM1098 (fabZ)
Lipid biosynthesis proteins [BR:ama01004]
 Fatty acid synthase
  Component type
   AM1098 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas Peptidase_S31
Motif
Other DBs
NCBI-ProteinID: AAV86954
UniProt: Q5P9S6
LinkDB All DBs
Position
991507..991950
Genome map
AA seq 147 aa AA seqDB search
MTMALDHKQIMRMLPHSYPFLLVDRVLECIPGKSIVALKNVTFNEPFFVGHFRDNPVMPG
VLIIESMAQSSMLCVVSDREGDEASGNRSVYFMSIDGAKFRRVVVPGDTLTIKSAVIHMR
GTTCKFQCHAYVGDELASEAQILAMMG
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggcgcttgatcacaagcagattatgcggatgttgccccactcgtatccgttc
ttgctagtggatagagttttagagtgcatccctggtaagtccatagtcgcgctaaagaat
gtaaccttcaacgagccgttttttgtggggcactttcgcgacaatccagttatgcctggt
gtgctgattatagagtctatggcacaatcttctatgctgtgtgtcgtaagcgaccgcgaa
ggggacgaggcaagcgggaaccggtcagtgtattttatgtcgatagatggagcaaaattt
cgcagggtggttgttccgggtgataccctaacgataaaatcggcagtaatccacatgcgc
ggcaccacctgcaaatttcagtgccatgcgtacgtcggggacgagctggcatccgaggca
caaattttggcaatgatgggttaa

DBGET integrated database retrieval system