KEGG   Anaplasma marginale St. Maries: AM1313
Entry
AM1313            CDS       T00216                                 

Gene name
virB11
Definition
(GenBank) VirB11 protein
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ama00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AM1313 (virB11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ama02044]
    AM1313 (virB11)
Enzymes [BR:ama01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     AM1313 (virB11)
Secretion system [BR:ama02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   AM1313 (virB11)
SSDB
Motif
Pfam: T2SSE AAA_7 DEAD AAA_28 AAA_16
Other DBs
NCBI-ProteinID: AAV87105
LinkDB
Position
complement(1157425..1158438)
AA seq 337 aa
MLCAHMTAGYAALETYLEPLQSIFAEDGVNEISINRECEVWVENRGDIRCERIESLTLSH
LKALGRLVAQATEQKLSEETPLLSASLPNGFRVQVVFPPACEGDKVVFSIRKPSTVQLSL
DDYEKMGAFSHVAQQGRKAMDVNKQLSELLDSGDIKSFIELAVLSKKNIIVSGGTSTGKT
TFTNAALRVIPKDERIITVEDSREIALDHPNRVHLLASKGGQGRAKVSTQDLIEACLRLR
PDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPRMAVEQLKLMVMQASLGLPPDQI
VSYITNIVDVIIQLKRESGGVRHVAEIMFTKCSQGND
NT seq 1014 nt   +upstreamnt  +downstreamnt
gtgttgtgtgcgcatatgacagcaggatacgcagcgttagaaacatacttggagcccctg
cagagcatattcgcggaggatggggtcaatgagatctcgatcaacagagaatgcgaggta
tgggtagagaacaggggcgatatacggtgtgagaggattgaaagtctaactctgtcgcat
ctaaaagcactcggcaggttggtagcacaagcaaccgagcagaaattgagtgaggaaacg
cctttgctgtcggcttctttgcccaacggcttccgcgtgcaggtggtgtttccccccgct
tgcgagggtgataaagtcgtattttccataagaaagccatcgacggtgcagttgtcgctc
gatgattatgaaaaaatgggtgcgttctcccatgtggcccagcagggccgcaaggctatg
gacgtaaacaagcagcttagtgagctcctggatagcggggatatcaaatctttcatagag
cttgcggtgctgagcaaaaaaaacataatcgtcagtggaggtacgtccactgggaaaact
acgttcacaaacgcggcgctgcgggtcatcccaaaggatgaaaggataataacggtggaa
gactctagagaaatagcgctagaccaccccaacagggtacatctattggcatccaagggc
ggccaggggcgcgctaaggtctctactcaagatcttatagaggcctgcttgcgtcttcgt
ccagatagaataattgttggggagctcaggggggctgaggcgtttagctttctcagagcc
ataaatactgggcacccgggttccatctcaaccttgcatgcagacacgcctagaatggct
gtagagcagctgaaacttatggtaatgcaagcgagtctagggttgccgccagaccaaata
gtaagttacattaccaacatagtagacgtaattatacagctgaaaagggagtctggaggg
gtgcggcacgtcgcggagattatgttcactaaatgttcacaaggcaatgattaa

DBGET integrated database retrieval system