KEGG   Anaplasma marginale St. Maries: AM168Help
Entry
AM168             CDS       T00216                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00020  Citrate cycle (TCA cycle)
ama00190  Oxidative phosphorylation
ama00650  Butanoate metabolism
ama01100  Metabolic pathways
ama01110  Biosynthesis of secondary metabolites
ama01120  Microbial metabolism in diverse environments
ama01130  Biosynthesis of antibiotics
ama01200  Carbon metabolism
Module
ama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ama_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM168 (sdhA)
   00650 Butanoate metabolism
    AM168 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM168 (sdhA)
Enzymes [BR:ama01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AM168 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AM168 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Lycopene_cycl Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAV86304
LinkDB All DBs
Position
143415..145214
Genome map
AA seq 599 aa AA seqDB search
MGAPGSAYKIVDHEYDVVVVGAGGAGLRAVVGMAAAGLSVACVSKVFPTRSHTVAAQGGI
SAALGNISEDDWRWHMFDTVKGSDWLGDQDAIEYMCKHAMEAVVELEHYGVPFSRTEDGK
IYQRPFGGMTTEYGKGKMAVRTCAASDKTGHAILHTLYQQALKYKVEFFVEYFAIDLIMS
ANNSACHGVVAWSLCDGTLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAGL
PMEDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSEGERFMERYAPKARDLASRDVVSR
AITMEIREGRGVGPKKDHVFLSIAHLDPAVIKERLPGISETAKTFAGVDVTKDPIPVLPT
VHYNMGGVPTNYYGEVILSEKGKIVAGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAA
ALRAKEIIKPGAPHAPIEESFVDAIVDRFDKLRFSRGGPRVAEVRDSMQRVMQDHAAVFR
TADILNEGKQKIREVASMAKDMSVSDRSMIWNSDLVEALELTNMLPQAVITMDCAANRTE
SRGAHAREDFPERDDENWMKHTMAWYDSKTHGVKIAYKSVATSTLTNEVEWFPPQKRVY
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgggagcacctgggtcggcatataaaattgtagaccacgagtatgatgttgtggttgtt
ggcgcggggggtgccgggctacgtgcggttgtcggcatggccgctgcgggcctatccgtg
gcgtgtgtgtctaaggtttttcccacccgtagccataccgtggctgcccagggtggcatc
agtgcggcgcttggtaatatttctgaggatgactggcggtggcatatgttcgacaccgtt
aaggggtctgactggcttggtgatcaagatgccatcgagtatatgtgcaagcatgctatg
gaagcggttgttgagcttgagcattatggggttcccttctcgagaactgaagatggcaaa
atataccagcgtccgtttgggggtatgactacagaatatggcaaaggcaagatggccgtg
cgtacctgtgctgcctcggacaaaactgggcatgctatattgcacactttgtatcagcag
gccctaaaatataaggtagagttttttgttgagtattttgcgatagatctgatcatgagc
gctaacaatagcgcttgtcatggcgttgttgcgtggtcattgtgtgacggcactctacac
aggttccgcgcgcacgcggtggttttggcaaccggtgggtatggcagggtatacttttcg
gcgaccagtgcccatacctgcactggtgatggtggcggtatggctgccagggccgggctg
cccatggaagacatggaattcgtgcagtttcaccccactggtatatatggttctggctgc
ttgatgaccgagggttgccgcggtgagggtggatacctgctgaactccgaaggggagagg
tttatggagcgctatgcgcccaaggcgcgggaccttgcctctcgtgacgttgttagcagg
gccataacaatggagatacgcgagggtaggggcgtcgggccgaagaaagaccacgtgttt
ctgtctatagcccatcttgaccctgcggtgataaaagagaggctgccaggcatcagtgaa
actgccaagacgttcgctggtgttgacgttactaaagatcctatcccggtcctgcctacg
gtacactataacatgggtggggtgccgacaaactattatggggaggttattctatcggaa
aagggaaagatagtagcagggctttttgcaatcggcgaggcggcatgtgtttctgtgcat
ggtgctaaccgcttgggctctaattccctactggacttggtggttttcggcagagcggct
gcgcttagggccaaggagatcatcaagcctggcgctccccacgcgccgatagaagaatcg
ttcgtagatgcaattgttgatagatttgataaactgcgcttttcacgcggtggcccccgg
gttgccgaggtgcgtgatagcatgcagcgtgtgatgcaagaccatgcggcggttttccgt
accgcagacattcttaatgaagggaaacagaaaatccgcgaggttgcctctatggcgaaa
gatatgtctgtttcggataggagcatgatttggaacagtgaccttgtggaagctcttgag
ctaaccaatatgctgcctcaggctgtgattaccatggactgtgctgcgaatcgcactgag
agcagaggcgctcacgcccgtgaggattttccggagcgtgatgatgaaaactggatgaag
cacaccatggcttggtacgatagcaagacccacggtgtgaagatagcctacaagagtgtt
gctaccagcacgcttacaaatgaggtggagtggtttcctcctcagaagagggtatactag

DBGET integrated database retrieval system