KEGG   Anaplasma marginale St. Maries: AM169Help
Entry
AM169             CDS       T00216                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ama  Anaplasma marginale St. Maries
Pathway
ama00020  Citrate cycle (TCA cycle)
ama00190  Oxidative phosphorylation
ama00650  Butanoate metabolism
ama01100  Metabolic pathways
ama01110  Biosynthesis of secondary metabolites
ama01120  Microbial metabolism in diverse environments
ama01130  Biosynthesis of antibiotics
ama01200  Carbon metabolism
Module
ama_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ama_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ama_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ama00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AM169 (sdhB)
   00650 Butanoate metabolism
    AM169 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AM169 (sdhB)
Enzymes [BR:ama01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AM169 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AM169 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer2
Motif
Other DBs
NCBI-ProteinID: AAV86305
LinkDB All DBs
Position
145239..146027
Genome map
AA seq 262 aa AA seqDB search
MVQISLPRNSKINPKGKVHNMAEGAQRVGCFKIYRWSPDDDEGPRIDTFYIDLDKCGQMV
LDALIKIKNEVDSTLTFRRSCREGICGSCAMNIDGSNTLACTKYISDIKGDVKIYPLPHM
NVIKDLVPDLSDFYAQYKSVSPWLKAKDPVSGTSERLQSVEDRSKLDGIYDCILCASCST
SCPSYWWNSDKYLGPAVLLQVYRWLADSRDEATDERLELLDDAFKLYRCHTIMNCTKTCP
KDLNPAKAISKIKQLMLKRLEL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagatatctctgccgcggaactctaaaatcaatcctaagggtaaagtgcacaac
atggcggagggcgcgcagcgtgtcgggtgcttcaagatataccggtggtctccagatgac
gatgaaggccctaggattgacacattctacatcgatttagataaatgcgggcagatggtc
cttgatgcgctgataaaaattaagaacgaggtggattccacacttacgttcaggaggtcc
tgcagagagggcatatgcggatcctgcgcgatgaatattgacggttctaacactctcgca
tgtacaaaatacatctctgacatcaaaggggatgtgaaaatctacccattgccccacatg
aacgtaattaaagacctagtgccagatcttagcgacttctatgcgcagtacaagtctgtc
agtccgtggcttaaggctaaggatcctgtttccggcactagtgagcgtcttcaaagtgtt
gaagacaggagcaagttggatggaatttatgactgcattctgtgtgccagctgcagcaca
agctgtccgagctattggtggaattccgacaaatacctggggcctgcggttctgctgcaa
gtgtatcggtggttggcggatagcagggatgaggcaactgatgaacggttggagctcctt
gatgatgcgtttaaactgtataggtgccacactattatgaactgtacaaaaacctgtcct
aaagacttaaatcctgcaaaggcgatctctaaaattaagcagctgatgctcaagaggttg
gagttatag

DBGET integrated database retrieval system