KEGG   Alteromonas mediterranea DE1: amad1_09110Help
Entry
amad1_09110       CDS       T02340                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00061  Fatty acid biosynthesis
amaa00780  Biotin metabolism
amaa01100  Metabolic pathways
amaa01212  Fatty acid metabolism
Module
amaa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    amad1_09110
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    amad1_09110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amaa01004]
    amad1_09110
Enzymes [BR:amaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     amad1_09110
Lipid biosynthesis proteins [BR:amaa01004]
 Fatty acid synthase
  Component type
   amad1_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc Peptidase_Mx1
Motif
Other DBs
NCBI-ProteinID: AFV85331
LinkDB All DBs
Position
2034397..2035635
Genome map
AA seq 412 aa AA seqDB search
MTKRRVVVTGLGMLSPLGLNSEDTWRKLLAGESGIGEITHFDCSNYSTRFAGQINDFDPQ
EYIEKKETKKMDRFIQLGIAAGKQALVDSGFTVSPDNAHRVGVAIGSGIGGLEQIEQNHL
KLTNSGPKRVSPFFVPSTITNMISGFLSIMEGLKGPNLNIVTACTTGVHNIGIAARTIAY
GDADAMLAGGAEASITPLGMAGFAAARALSSRNDDPQAASRPWDKDRDGFVMGEGAGVVM
LEEYEAAKARGATIYAELVGFGMSGDAYHMTSPPADGEGAAASMQNAINDAKLDASEIGY
VNAHGTSTPAGDIAEVAAVKRVFNDHAYKLLVSSTKSMTGHLLGAAGSVEAIFTILALRD
KMAPPTINLDEPGEGCDLDFVANKAKAFSEDYALCNSFGFGGTNGSLIFKRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaacgtcgcgtagtggttactggtcttggaatgctttcaccattaggtcttaat
agcgaagacacatggcgcaaattgctcgcgggcgagagcggcatcggtgaaatcacccat
tttgattgcagtaactattcaacccgtttcgcaggtcaaattaacgactttgatccgcag
gaatacatagaaaagaaagaaaccaagaaaatggaccgctttatccagttgggtatcgct
gccggcaaacaagccttggtcgattctggttttactgtttcaccagacaatgcgcaccgt
gtaggcgtagctattggttcaggaattggtggtttagagcaaattgaacaaaaccactta
aaactgacaaatagcggtcctaagcgcgtgtcgccattttttgtgccatcaaccattacc
aatatgatttcaggctttttgtctatcatggaagggttgaaaggaccgaatttgaacatt
gtgactgcttgtactacaggtgttcacaatataggtattgccgcaagaaccattgcttac
ggcgatgctgatgccatgcttgcaggcggcgcagaggcgtcaattacgccgctaggaatg
gctggttttgccgctgcgcgagccctgtcttcgcgcaacgacgatccacaagccgcaagc
cgcccatgggataaagaccgtgatggttttgtcatgggtgagggcgctggcgtagttatg
cttgaagaatacgaagccgctaaggcccgtggtgcgactatctatgctgagcttgttggt
ttcggtatgagtggcgatgcctatcacatgacatcaccgccagcagatggcgaaggtgcc
gcggcgtcaatgcaaaatgcaattaacgacgccaagttagatgcgagcgaaattggttat
gttaacgcacacggtacctcaacccctgccggtgatattgccgaagtcgccgcggtaaaa
cgcgtatttaacgaccacgcatacaaactgctggttagctcaacaaagtcgatgacgggt
catttacttggtgctgcaggatcagttgaagccatcttcactattttggcactgcgtgac
aaaatggcgccaccgaccatcaacttagatgagccgggcgaaggctgtgacctagacttc
gtggcaaataaagccaaagccttcagcgaagattacgcgctatgtaactcttttggattc
ggcggtactaacggctcgttgatatttaagcgtatataa

DBGET integrated database retrieval system