KEGG   Alteromonas mediterranea DE1: amad1_09155Help
Entry
amad1_09155       CDS       T02340                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amaa  Alteromonas mediterranea DE1
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amaa01002]
    amad1_09155
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amaa04147]
    amad1_09155
   04090 CD Molecules [BR:amaa04090]
    amad1_09155
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     amad1_09155
Peptidases [BR:amaa01002]
 Metallo Peptidases
  Family M2
   amad1_09155
Exosome [BR:amaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   amad1_09155
CD molecules [BR:amaa04090]
 Proteins
  amad1_09155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AFV85340
LinkDB All DBs
Position
complement(2044967..2046787)
Genome map
AA seq 606 aa AA seqDB search
MLNHKRTLIAALVSLSLIGCGESTTQTETQAALTAKDAKQFLQQAQDDIAKMQVPAAHAE
WSYATNINFDTAAVSAYFNEVLSTKVAKLAKEAAKFNDVDVDSDTRRQLDLLKNGLTMPP
PADAAKAERLAKIGSDLSAMYGSGEYCSEDGTCKSLVEMSSEMATLRDADKLLEYWAGWR
EISKPMAPLYAEQVELANEGAAELGFENVSALWRGKYDMPADEFPKELDRLWTQVEPFYE
SLHCHVRAKLGEHYGEDVVPQDKPIPAHLLGNMWAQSWGNIYDIVKPQQEMQVPDVTAAL
AEQGYDEIAMVKQAESFFSSLGFEELPDTFWERSMFQKPEGRDVQCHASAWDLDDKDDLR
IKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKYL
KQIDLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMSGEVTPDQYNDLWWEL
REKYQGVMAPVERSANAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPLN
RCSIYGSKEAGKALNEMLEMGMSQPWQNALETLTGSPQMDASTIADYFAPLKTWLDKQNA
TRQCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcataaacgtactctgatagcagcactggtaagcctatcgcttataggatgt
ggcgaaagtactacgcagacagaaacccaagcggcactgaccgcaaaagacgcaaaacag
ttcctccagcaagcacaagatgatattgcgaagatgcaggtacccgctgcgcacgcagaa
tggagctatgcgaccaatatcaatttcgataccgctgcggtaagcgcctactttaatgaa
gtgctatcaacaaaagtagcaaagttagccaaagaagcggccaaatttaatgatgtagat
gtggacagtgatacccgcagacaactcgatttattaaaaaatggcttaaccatgccacca
cctgcagatgcagctaaagctgagcgcttagccaagattggctctgacctaagtgccatg
tacggctcgggtgagtattgtagcgaagatgggacgtgcaaaagcttagtagaaatgagc
agtgaaatggccacccttcgtgacgccgataaattattagaatattgggcaggctggcgc
gaaatatctaaaccaatggcaccgctttacgcagaacaagtggagctggcaaatgaaggc
gcggcagagctgggttttgaaaatgtgagtgcactgtggcgcggcaaatatgatatgcct
gctgatgagtttcccaaagagctagaccgcttgtggacgcaagtagaacctttttatgaa
tcacttcattgtcatgtacgcgcaaagcttggtgaacattacggtgaagatgtagtacct
caagacaaacccattccggcccaccttttaggcaatatgtgggcacagtcgtggggtaac
atttacgatatcgtaaaacctcaacaagaaatgcaggtaccagatgtaaccgctgcgttg
gctgaacaaggctatgacgaaatcgctatggttaaacaggctgaatcatttttctcatcc
ctaggctttgaggaactgccagatacgttctgggaacgctctatgtttcaaaaaccagaa
ggccgtgacgtacaatgccatgcttctgcgtgggatttagatgacaaagacgaccttcgc
ataaaaatgtgtattcaaaagacaggcgaagagttcaacgttattcaccatgaattaggt
cacaactattatcagcgcgcctataaagatcagccactgctctatcgcggttcagctaac
gacggtttccatgaagcgattggcgacactatcgcactatcaattacgcctaaatacctc
aaacaaattgatttgattgatgaaatcccagatgcgtcgaatgatatcggcatgttgatg
caggtagcgcttgataagatcgcgtttattccttttggtttaatggttgaccaatggcgt
tggaaggtgatgtcgggggaagtaacacctgaccaatacaatgacctgtggtgggagctt
cgagagaagtatcaaggtgtgatggcacctgtcgagcgaagtgcaaatgcctttgaccca
ggtgcaaagtatcatgtaccagcaaatgtaccctacacgcgctatttcctagcgcacatc
cttcaattccagttccacaaagccttgtgtgatatagctggtgatgaaggcccgctaaat
cgctgctctatttacggcagtaaagaagccggtaaggcgctaaacgagatgctggaaatg
ggcatgagtcaaccgtggcagaacgcgttagagacactaacgggctcgccgcaaatggat
gctagcaccattgctgattacttcgcgccgctcaaaacgtggttagataagcaaaatgcg
acacgccagtgcggttggtag

DBGET integrated database retrieval system