KEGG   Alteromonas mediterranea DE1: amad1_15335Help
Entry
amad1_15335       CDS       T02340                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amaa  Alteromonas mediterranea DE1
Brite
Enzymes [BR:amaa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     amad1_15335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFV86561
LinkDB All DBs
Position
3453858..3454403
Genome map
AA seq 181 aa AA seqDB search
MKKRLLSTLAGSISLILSAGSLAGHHQHEGKEVVMNNLKTNQSMGTVKVSSYDDDGVVFT
PNLSGLTPGIHGFHVHQNGDCSTAMKDGKKILGGAAGGHFDPEDTNKHRAPWSEKGHEGD
LPVLYVDENGKATQPIFAPELELEDIEGRALMIHAGGDNYSDSPKKLGGGGERVACGLIG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtttattatctaccctagcagggtctatctcactgattctaagtgcaggc
agcttagcaggtcatcaccaacacgaaggaaaagaggtggtgatgaataaccttaaaacc
aaccagagcatgggtactgtaaaggtaagcagttacgacgatgatggtgtggtttttacg
cctaacctttccggtttaacgccgggtatacacgggtttcacgttcatcaaaatggtgat
tgctcaacggctatgaaagacggtaaaaaaatacttggtggcgctgccggcggacacttc
gacccagaagataccaataaacacagagctccatggtctgagaaagggcacgaaggcgat
cttcccgtgctgtatgttgatgaaaacggaaaagccacgcagcctattttcgccccagag
ctagagcttgaagatattgaaggacgtgcacttatgattcacgcaggcggcgacaactac
tcagactcccctaaaaaactaggtggtggcggcgaacgcgttgcttgtggcctaatcggt
aaatag

DBGET integrated database retrieval system