KEGG   Alteromonas mediterranea DE1: amad1_17390Help
Entry
amad1_17390       CDS       T02340                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00620  Pyruvate metabolism
amaa00680  Methane metabolism
amaa01100  Metabolic pathways
amaa01120  Microbial metabolism in diverse environments
amaa01200  Carbon metabolism
Module
amaa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    amad1_17390
  09102 Energy metabolism
   00680 Methane metabolism
    amad1_17390
Enzymes [BR:amaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     amad1_17390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 T4_tail_cap
Motif
Other DBs
NCBI-ProteinID: AFV86957
LinkDB All DBs
Position
3921096..3923717
Genome map
AA seq 873 aa AA seqDB search
MQTHYDAELKDTVRYLGKTLGETIKNQLGQEWLDRIEKIRKGGRASYQGDATCSEELKET
FKTMSDSDLLTVGRAFAQFLNLGNIAEQEYNAAMNVDASIDALFKHLDKAELTADKVQDA
VAKLNIDLVLTAHPTEVTRRTLIHKHKELADCLQAVHQASLSDVERKKIETRIADLIAQA
WHTEEIRSVRPTPVDEARWGFSVIENSLWEAVPDFMRELDGRLNEDYDVSLPLDASPVQF
SSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFALDLDRLQVELSMYDCNDELRDKVGD
ANEPYRALLRPLVNKFIATRDGIADYLAGKNPDTSNWIESDDELIEPLMLCYQSLIDCGM
QVVANGLLLDTIRRARVFGIHLLRLDVRQDSERHADVFSELTRYLGLGDYAQWSEADKQA
FLLRELGSKRPLFPAQWDASDDVKEVLDTCKVIAKHSKHGFGIYIISMASEPSDVMAVQL
LLQESGVDWPMPVAPLFETLDDLNNSPDVMRKLLSIDWYRGYVKGRQFVMIGYSDSAKDA
GALAAGWAQYQSQEALVAIAEEFDVSLTLFHGRGGTIGRGGLPAHAAIYSQPPGSLEGGF
RVTEQGETIRYKFGMPKLAKRSLGIYASAIIEAMLFPPPAPKEEWRELITTMAAQGRDNY
RATVRHDEEFVPYFRVATPEQELGKLPLGSRPAKRKPQGGIESLRAIPWIFAWAQTRLVL
PSWLGVMRAIDSVKTPENEKVVNEMFSEWPFYRSRLSMLDMVFHKADPRISEAYDERLVP
KELKHFGEALRSELKESISSLLAITGDDDIMKNDPQGKESMEIRAGYLQPLHYLQIELLD
RIRKAGDDAQNTSLERAMMVTIAGIAIGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacactacgatgctgaactgaaagataccgttcgataccttggtaaaaccctt
ggtgaaacaatcaaaaatcaattaggtcaggagtggctagaccggattgaaaagattcga
aaaggcggccgagcttcttatcagggagacgctacttgtagcgaagaactgaaagaaact
ttcaaaacaatgtctgacagcgatttgcttactgttggtcgtgccttcgcacaattcttg
aacctaggtaatattgccgagcaagaatacaacgcggcaatgaatgttgatgcatctatt
gatgcccttttcaaacacctagataaagcagaacttaccgcagataaagtacaagacgcg
gttgcaaagctgaacatcgaccttgttcttaccgctcaccctactgaagtaacacgccgt
acactcattcacaagcataaagaacttgctgactgtcttcaggcagtgcatcaagcctcg
cttagcgatgttgagcgcaaaaaaattgaaacgcgtattgccgatcttatcgcgcaggcg
tggcacactgaagaaattcgttccgttcgcccgacgcctgttgatgaagcgcgttggggc
ttctcggttattgaaaactcgctatgggaagccgtacctgactttatgcgcgagcttgat
ggccgcttaaacgaagactacgacgtatcgctaccgctagacgcgtcacccgtacaattt
agctcgtggatgggcggcgacagagacggtaacccatttgttacttcaaaagtaactgag
caagtactgctgctggcaagaaaacgtgcagctaaacttttcgcgctagaccttgatcgt
ttgcaagtcgagctatcaatgtacgattgcaacgacgaactacgcgacaaagtaggcgat
gcaaacgaaccgtaccgcgccctacttcgcccgctggtaaacaagtttattgcgactcgc
gatggcattgccgactacttggccggcaagaatccagacacgtctaactggattgaaagc
gacgacgagcttatcgagccgctaatgctttgctaccagtcattaatcgactgcggtatg
caagtagtggcaaacggccttctactagatactatccgtcgtgctcgtgtattcggtatt
caccttcttcgccttgacgtacgtcaagattctgagcgtcacgccgacgtatttagtgag
ctaactcgctacctaggtttaggcgattacgcacagtggagcgaagccgacaagcaagcg
ttcttattacgtgagcttggctcgaaacgtccgttattcccagcgcaatgggatgcatct
gacgatgtaaaagaagtgctagatacctgtaaggtgattgcgaaacacagcaagcacggc
ttcggtatctacattatctctatggcaagtgagccatcggatgtcatggcggttcagctg
cttcttcaagaaagcggtgtagactggccgatgccggtagcaccactatttgaaacgctt
gacgatttgaacaactcaccagatgtaatgcgcaaactcctgtctatcgactggtatcgc
ggttacgtgaagggccgtcagttcgttatgatcggttactctgattcagcgaaagatgca
ggcgcattggctgctggctgggcacagtatcagtcgcaagaagcattggttgccattgca
gaagagttcgacgtaagcctaaccctgttccacggacgtggcggtacgattggtcgtggt
ggattgccagcacatgcggcaatttactcacagcctcctggctcactagaaggcggtttc
cgcgtaacagaacagggcgaaactattcgctataagttcggtatgccaaaactggctaaa
cgcagcctaggtatttacgccagcgccattattgaagccatgttgttcccacctccggca
ccaaaagaagagtggcgtgagcttattaccaccatggcagcgcaaggtcgtgataactac
cgtgcaactgtacgtcacgatgaagagtttgtaccttacttccgcgtggctactccagag
caagagctaggtaaactacctctaggcagccgccctgctaagcgtaaaccacaaggcgga
attgagagcttacgtgctatcccatggatcttcgcttgggcacagacacgtttagtgctg
ccaagctggttgggcgttatgcgcgctattgatagcgtgaagactcctgagaacgagaaa
gtggttaacgagatgttcagcgaatggccgttctatcgttcacgcctttctatgttagac
atggtgttccacaaagctgacccacgcattagcgaagcttatgatgagcgcttggtaccc
aaagaacttaaacactttggtgaagcattgcgtagcgagcttaaagaaagcatctcttca
ctgctggctatcacaggcgatgacgacattatgaagaacgacccgcagggtaaggaatcg
atggagatccgcgcaggataccttcagccgcttcattacctgcaaattgagcttctagat
cgtatccgtaaagccggtgacgatgcgcagaacaccagtctagaacgtgccatgatggtt
accattgccggtattgctatcggcatgcgtaacacgggttaa

DBGET integrated database retrieval system