KEGG   Alteromonas mediterranea DE1: amad1_18690Help
Entry
amad1_18690       CDS       T02340                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa03030  DNA replication
amaa03410  Base excision repair
amaa03420  Nucleotide excision repair
amaa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amaa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    amad1_18690
   03410 Base excision repair
    amad1_18690
   03420 Nucleotide excision repair
    amad1_18690
   03430 Mismatch repair
    amad1_18690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amaa03032]
    amad1_18690
   03400 DNA repair and recombination proteins [BR:amaa03400]
    amad1_18690
Enzymes [BR:amaa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     amad1_18690
    6.5.1.6  DNA ligase (ATP or NAD+)
     amad1_18690
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     amad1_18690
DNA replication proteins [BR:amaa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    amad1_18690
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     amad1_18690
DNA repair and recombination proteins [BR:amaa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     amad1_18690
   NER (nucleotide excision repair)
    Other NER factors
     amad1_18690
   MMR (mismatch exicision repair)
    Other MMR factors
     amad1_18690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase mRNA_cap_enzyme Mei5
Motif
Other DBs
NCBI-ProteinID: AFV87215
LinkDB All DBs
Position
4238490..4240178
Genome map
AA seq 562 aa AA seqDB search
MEAFSNLLEQLYYTAGTKAKAQLIADYIANTPDPDRGWAIAAMAGTLRFDFFKRNTVKKL
ITEHTDPALFAMSYDYVGEVSETVAHLWPHSEPTDSLPSLTEVVETFASVSKQKVSDTLA
HYLTIMTPAQRWALLKLGTRGLRIGVSARSIKQILADYGNKDIKDIETLWHAVTPPYVDM
LSWLEGKADKPDIENAVTFHPVMLSHPIEDSDIDAFTKDTWQIENKYDGIRVQLAVKTGK
VSDENEPDKALFSRTGDDISHSFPDLLESVNGNMVLDGELLVIHNAENDQGSKKRGEAST
KTHDDSGATQSNAALQPDVDTFNTLQQRLNKKKPSKALQTSAPVGLIVYDALVLNGEDLT
EKTLKARRQALEKWFSENSNNRLFLSETLTATSPQSLRKLHAQVCQNRAVEGLMIKRLDS
KYIPGRPKSKWFKWKRDPLVVDAVMMYAQRGHGKRSSFYSDYTFGAWEDNQLLPIGKAYS
GFTDEELKKLDNWVRRNAVGRFGPVREVKKELVLEVAFDAAHPSSRHKSGVALRFPRIHR
IRWDKPADEADTLANVKALIEQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcattcagtaacttacttgaacagctttattacaccgctggaaccaaggcaaaa
gcgcagcttatcgctgactacattgccaatacgccagaccctgaccgcggctgggccatt
gccgctatggcaggcacgctgcgcttcgattttttcaagcgtaatacggtaaagaagctt
attaccgaacacaccgaccccgccctttttgccatgagctacgattatgtcggtgaagtt
agcgaaaccgtggcccatttatggccgcatagcgagcctacagactcgcttccaagcctt
acggaagtggtagaaacgtttgcgtcggtgagtaagcaaaaggtgtctgacaccttggcc
cattatctaaccataatgacccctgcccagcgctgggcgttactgaaactagggacgcgc
ggtctgcggataggcgtgtcggcccgctctattaaacaaatactcgcagattacggcaac
aaagatatcaaggacattgaaaccttatggcacgcggtaaccccgccctacgtggatatg
ctttcatggctagaaggcaaagccgataaacccgatattgaaaacgcggttacctttcac
ccggtgatgctttctcaccctattgaagatagcgacattgacgcattcactaaagacaca
tggcaaattgaaaacaagtacgacggtattcgcgttcagcttgcggttaaaacaggtaaa
gtgtctgacgaaaacgagcctgacaaagcgctattttctcgtacgggcgacgatatcagt
cattcgttccccgatttactagagtccgtaaacggtaatatggtgctagacggtgaactc
ctggtaattcataacgcagaaaacgaccaaggctcaaaaaagagaggcgaagctagtaca
aaaactcacgatgacagcggtgctactcagagtaacgctgccttacagccggatgtggac
acctttaacacccttcagcagcgccttaataagaaaaaaccaagcaaagcgctacaaact
tctgctcctgtagggctcattgtgtacgacgccttagtgcttaatggtgaggatctcact
gaaaaaactttgaaagctcggcgccaagcccttgaaaagtggtttagcgaaaatagtaac
aaccgtttgtttctatcagaaacccttaccgctacctcccctcaaagccttcgcaagctt
cacgctcaagtttgtcaaaaccgtgcagttgaagggctgatgataaagcgccttgatagt
aagtacattcccggccggccgaagagtaagtggtttaaatggaagcgcgatccgctggtt
gttgacgcggttatgatgtacgcgcagcgggggcacggaaaacgttcaagcttctattct
gattacacctttggcgcatgggaagacaaccagctactgcctattggaaaagcgtactcc
gggttcactgacgaagagcttaagaagcttgataattgggtaagacgcaatgccgtcggc
cgctttgggccagtaagagaagtaaaaaaagaactggtgcttgaagtggccttcgacgca
gctcacccttcatcaagacataaatcgggcgtcgcgctgcgctttcctcgcattcaccgt
attcgctgggacaagcccgctgatgaagctgacacgctagccaatgtgaaagccttgata
gagcaatga

DBGET integrated database retrieval system