KEGG   Alteromonas macleodii ATCC 27126: MASE_01735Help
Entry
MASE_01735        CDS       T02246                                 

Definition
(GenBank) bifunctional murein transglycosylase/transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00550  Peptidoglycan biosynthesis
amac01100  Metabolic pathways
amac01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:amac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MASE_01735
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MASE_01735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amac01003]
    MASE_01735
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amac01011]
    MASE_01735
Enzymes [BR:amac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     MASE_01735
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MASE_01735
Glycosyltransferases [BR:amac01003]
 Polysaccharide
  Bacterial polysaccharide
   MASE_01735
Peptidoglycan biosynthesis and degradation proteins [BR:amac01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   MASE_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AFS35916
LinkDB All DBs
Position
403847..406510
Genome map
AA seq 887 aa AA seqDB search
MKYIKPLILFSFLSGLLGFAALVGIYFYIKPDLPSVTVLKDVRLQTPMQIYTKDGKLISQ
YGVKRRIPVKLEEVPQELINAILATEDSRFYEHHGIDPIGIMRAAVSLVLTGEKRQGAST
LTMQLARGFFLSREKTYIRKIKEIFIALHMEQELSKQEILELYLNKIELGHRAFGFGAAA
QVYYGKPLNELSLAQIATIAGLPKAPSVLNPISGPQRSVERRRVVLLRMLDEEYITKAQF
DEAANAPVSAKKHGAEIEVDAPYLADTIYNEMVEIYGKEEAETGGYQVFATATSDLQLAA
QRAVVRNLHDYDERHGYKGALGYLWNIPKPEGKDDAIPQLSLSYDISDKTTREEWDNESI
MRVLEEIPHIKPLLPSVVTKVNEQSIEVLSVDGKAITVEWDGLDWARRYITDFRQGSDPK
TASDVTQEGAVIYIRQQEGQWRISQIPEVSGAFIALNPKNGAVEAVVGGYSFYQSQFNRA
TQAKRQVGSNIKPFVYSAALDSGYTLASIINDAPINQWNAATGVAWRPQNSPAEYDGPIR
MRKALGKSKNVVSVRLLRGVGLRETADYLTRFGFNKDDIPLDETVSLGSSSHTPLEVVRG
MSVIANGGYLVNPHFISKVLDENGDELWKANPVWACNRCENQSDPEILPEDEEADIEALL
AAELNQDILLGDVDDDEAAEKVIAPQVITAQNAFLVAEMMRTAVRANGNWSKKTYWLGTG
WRARNILQRTDIAGKTGTTNDSRDTWFSGFHKDLVATTWVGFDNMGRQLGRATRNQNLIN
KNAEKFNWIGNAMIGIEDGAKAAEPAWIRFMQHALENKPHTPMPVPENIVRVRIDRTSGK
LTRRTDHTTLFEYFLQGTEPTTYVRDDEVLDPATQDTTTAPEPEEIF
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacatcaaaccacttattttatttagttttctatcaggccttcttggttttgca
gcactggtaggtatttacttttatatcaaacctgacctaccaagtgttactgtacttaag
gatgtacgcctgcaaacacccatgcagatatacaccaaagacggaaaacttatttcacag
tatggagttaaacggcggatccccgtaaaacttgaggaagtcccgcaagaattaattaac
gccatactcgctaccgaagacagtcgcttctacgaacaccacggtattgaccccattggt
ataatgcgtgctgcagtaagtttagtccttactggcgaaaagcgtcagggagcaagtacg
ttaaccatgcagctagcacgagggtttttccttagtcgggaaaaaacctatatcagaaag
atcaaagaaatctttatagcactgcacatggagcaagagctttctaagcaggaaattctt
gagctgtacctcaacaaaatcgaattgggccatagagcttttggttttggggcggccgcc
caagtgtactatggcaaaccgcttaacgaactctctttagctcaaattgctactattgca
ggtcttccaaaggcgccatcagtgcttaaccctatcagcgggccgcaacgttctgtcgaa
cgcagacgcgtggtcttacttcgtatgcttgacgaagagtacatcactaaagcgcagttc
gatgaagctgccaatgcgccagtttcagcgaagaagcacggtgctgaaattgaagtggat
gcgccttatttggccgacaccatttataacgaaatggtagagatttatggaaaagaagaa
gcagaaaccggcggataccaagtttttgcgactgcaacgtcagatcttcaattagctgct
cagcgtgcggtggttcgaaatcttcatgactatgatgagcgtcatggctataaaggcgcc
cttggctacttatggaatattcctaagccagaaggaaaggatgacgcgattccacaactt
tcattgagctatgacataagtgataagacaacacgagaagagtgggataacgaatcaatc
atgcgcgtgcttgaagagattcctcacattaaacctcttttgccatcggttgttacgaaa
gtaaatgagcagtcgatagaagtgttgtctgtagatggcaaagcaataacagtcgagtgg
gatggactagattgggcccgacgctacattacagactttaggcagggtagtgatcccaaa
accgcttcagatgtgactcaagaaggggcggtcatttatatcagacagcaagaagggcag
tggcgcatttcgcaaatccctgaggtgagcggagcgtttatcgcacttaatccgaaaaac
ggtgcggttgaagcggttgttggtggctacagcttttatcaaagccagtttaaccgagca
acacaggccaagcgccaagtgggctcgaacatcaagcctttcgtttattctgctgcatta
gacagtggctatacccttgcatccatcatcaatgacgctcctattaaccaatggaatgcg
gcgacgggtgtagcttggcgaccgcaaaactcgccagctgagtacgacggcccaattaga
atgcgtaaagcccttgggaaatcgaaaaacgtggtatcggttcgactattgcgtggtgtt
ggtcttagagaaacggccgattacttaacgcgcttcggttttaataaagacgatatccca
cttgatgaaaccgtatcccttgggtcgagttcacatacgccgcttgaagtagtaagaggt
atgtcggtcattgcgaacggtggctacttagtaaaccctcattttatcagcaaagtgctt
gatgaaaacggcgatgagctttggaaagcaaacccagtttgggcgtgcaatcgttgtgaa
aatcaaagcgatccagaaatactacctgaagacgaagaagccgatattgaagccttactt
gccgctgaactaaatcaagatattttacttggcgacgtcgatgatgacgaagctgcagaa
aaagtgattgcgcctcaggttattactgctcaaaacgctttcttagtggcagaaatgatg
cgaacggctgtgagagcaaacggaaattggagcaagaaaacctattggttaggcaccggc
tggcgtgctcgtaatattcttcagcgtactgacatagctgggaaaacgggtacaacgaat
gactcgcgagacacgtggttcagtggtttccacaaagatttggtggccaccacatgggta
ggcttcgacaacatggggcgtcagttagggcgagctacgcgaaaccaaaaccttattaat
aagaatgctgagaaattcaactggataggcaacgcaatgatcggcattgaagatggagct
aaagctgctgagccagcgtggatcagatttatgcaacatgctctagaaaataaaccacat
acgccaatgcccgtaccagagaatatagtgcgtgttcgcattgatcgtaccagtggaaag
ttgaccagacgaacagaccatacgacactattcgaatatttcctgcagggaaccgagcca
acgacttatgttcgcgatgacgaagtgttggatccggccacgcaggatacgactactgcg
cctgagccagaagaaatattctaa

DBGET integrated database retrieval system