KEGG   Alteromonas macleodii ATCC 27126: MASE_05060
Entry
MASE_05060        CDS       T02246                                 

Gene name
alaS
Definition
(GenBank) alanyl-tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:amac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MASE_05060 (alaS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amac01007]
    MASE_05060 (alaS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:amac03016]
    MASE_05060 (alaS)
Enzymes [BR:amac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     MASE_05060 (alaS)
Amino acid related enzymes [BR:amac01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   MASE_05060 (alaS)
Transfer RNA biogenesis [BR:amac03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    MASE_05060 (alaS)
 Prokaryotic type
    MASE_05060 (alaS)
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD HlyD_2 FliD_C NBP1
Other DBs
NCBI-ProteinID: AFS36559
LinkDB
Position
1182228..1184825
AA seq 865 aa
MTLSTADLRNKFIDYFKSHGHQAVASSSLVPADDPTLLFTNAGMNQFKDCFLGAEKRSYT
RAVSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIEFAWNFLTKEIG
LPKEKLLVTVYSEDDEAFDIWENHIGVPKEKIIRISTSDNFWSMGDTGPCGPCSEIFYDH
GAHIWGGPPGTPEEDGDRFIEIWNLVFMQFNKQADGTMEPLPKPSIDTGMGLERISAILQ
NVHSNYEIDLFQNLIKSAASIVGSEDLENKSLRVIADHIRSCSFLICDGVMPSNEGRGYV
LRRIIRRAVRHGYQLGANDIFFYKLVASLAKEMGEAYPELVDQLPVIEKVLRVEEEQFSK
TLARGMAILNDTLETLEGDTVPGDVVFKLYDTYGFPTDLTNDVAREHDLKIDEEGFEAAM
QAQRARAQQASNFGADYNSKLAIDHTTSFTGYTDVEGQANVVELIADNAFVEKLEDGQEG
VVVLDSTPFYAESGGQAGDKGVLRVANGEFIVTDTQKMGNAFAHKGIAKGSVSKGDTATA
AIDAANREAIKKNHSATHLLHAALREILGEHVTQKGSLVEAPRMRFDFSHFEAVTAEQLA
EIERRVNQEIRANHTLATELMDLDEAKASGAMALFGEKYDEKVRVVTMGPFSVELCGGTH
VTRTGDIGLFKITSEAGIASGVRRIEAVTGEHALEVVQTQQATLSSLSALLKTDSQNVLD
RVVSLQNQTKELEKALNSAKQKLASQQGADMLSNAVEINGVKVLIANLEGVEAKSLRSMM
DDIKNRIGEGIVVLGVANDAKVNLIAGVTKNLTSKVKAGELVNFVASQVGGKGGGRPDMA
QAGGDQPENLGQALDSVNAWLQDKL
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgacattatcaactgctgacttacgtaacaagtttatcgattattttaaaagccatggc
caccaagcggtggcgagctcgtcactggttccggcagatgatcccacacttctttttacc
aacgcgggcatgaaccagtttaaagactgttttttaggtgcggaaaaacgcagctatacc
cgtgcggtatcgtcacagcgctgcgttcgcgcaggtggtaagcataacgaccttgagaac
gtaggttacactgcgcgtcaccataccttttttgaaatgctgggtaatttcagctttggc
gattatttcaaaaaagaagcgatagagtttgcatggaatttccttaccaaagaaattggt
ttgccaaaagaaaagctcttagtcaccgtttattctgaagatgacgaagcgttcgacatc
tgggaaaaccatattggtgttccaaaagaaaagattattcgcattagcacgtcagataac
ttctggtctatgggcgataccggtccatgtggtccttgttctgaaatcttttacgatcac
ggtgcgcacatttggggaggtcctccgggaacaccagaagaagacggcgaccgctttatc
gaaatttggaacctggtatttatgcagtttaacaaacaagctgacggtaccatggagcca
ctccctaagccttcaatcgataccggtatgggcctagagcgtatttccgctatcttgcag
aacgtgcacagcaactacgagatcgaccttttccaaaacttgatcaaatcagcagcatca
attgttggaagcgaagatttagaaaataaatcgctacgggttatcgccgatcacattcgt
tcgtgcagcttcttaatttgcgatggcgttatgccatcaaatgaagggcgcggatacgta
ttacgtcgcattattcgtcgcgctgttcgccacggctatcagcttggcgcaaacgatatc
ttcttctataaacttgtggcatcacttgccaaagaaatgggtgaagcgtatccagaactt
gtagaccagctaccggttattgaaaaagtactacgtgttgaagaagagcagtttagcaaa
acgttagcccgtggtatggctatcctaaacgatacattagaaactctagaaggcgacaca
gtgccgggtgacgtagtgttcaagctttacgacacctatggtttccctactgatttaacc
aatgatgtagcacgagagcacgaccttaagattgacgaagaaggttttgaagctgctatg
caagcacagcgtgcccgtgcacagcaggctagcaactttggtgcagactacaatagtaaa
ctcgccattgaccacacaacctcatttactgggtacaccgatgtagaaggccaggcgaat
gtggttgaacttattgccgacaatgcgtttgttgagaagcttgaagacggtcaagaaggc
gttgtggtattagacagcacaccgttctacgctgaaagtggtggtcaggctggagataaa
ggtgtgcttcgcgtggcaaacggtgaattcatcgttaccgacacccaaaaaatgggtaat
gcgtttgcacacaaaggtattgctaaaggttcggtatctaaaggtgatacggcaaccgca
gcgattgatgcagcaaatcgtgaagccattaaaaagaaccacagcgcaacgcatttactt
catgcagcactgcgtgaaattttaggtgagcacgtaactcagaaaggttcattggttgaa
gcgccgcgcatgcgttttgacttctcgcattttgaggcagtaacggctgagcaacttgct
gagattgaaagacgagttaaccaagaaatacgtgcaaaccacacgttagcaactgaacta
atggatttggatgaagccaaagcatcaggcgcaatggcgttatttggtgaaaagtacgac
gaaaaagttcgcgtggtaaccatggggccattctctgttgagctatgtggtggtactcac
gttacacgtactggtgatattggcttgtttaaaattaccagtgaagcgggtattgcatcg
ggcgttcgacgtatcgaagcagttactggcgagcatgcacttgaagtcgtgcaaacccaa
caagcgacactgtcttcattgtctgcgttattgaaaacagacagccaaaatgtacttgat
cgcgtagtttctctacaaaatcagactaaagaactagaaaaagcactcaattctgcgaaa
caaaaactggcgagtcagcaaggtgctgatatgcttagtaatgcagtagagataaatggc
gttaaagttcttattgcgaatttggaaggtgttgaagcgaagtcattgcgttcaatgatg
gatgacattaaaaaccgaattggtgaagggatcgtagtattaggtgtggctaatgacgcg
aaagtgaatcttattgctggcgttactaaaaacctcactagtaaagttaaagcgggcgag
ctagttaactttgtcgcatcacaagtaggtggcaaagggggcggtcgtccagatatggca
caggcaggcggtgaccagcctgaaaacttgggccaggcgctagattcggttaacgcttgg
ttacaagataagctataa

DBGET integrated database retrieval system