KEGG   Alteromonas macleodii ATCC 27126: MASE_07965Help
Entry
MASE_07965        CDS       T02246                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Brite
Enzymes [BR:amac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     MASE_07965
Peptidases [BR:amac01002]
 Metallo Peptidases
  Family M2
   MASE_07965
Exosome [BR:amac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MASE_07965
CD molecules [BR:amac04090]
 Proteins
  MASE_07965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AFS37124
LinkDB All DBs
Position
complement(1866470..1868353)
Genome map
AA seq 627 aa AA seqDB search
MLEHVYVNVDSRKNTIIKGQSMLNHKRTLIAALVSVSLMGCGESTTQTETKPQLTAQDAK
QFLTQAQNDIAKMQVPAAHAEWSYATNINFDTAAVSAYFNEVLSTKVAKLAKEAAKFNDV
DVDADTRRQLDLLKNSLTMPPPADAEKAERLAKIGSDLSAMYGSGEYCSEDGTCKSLVEM
SSEMATLRDADKLLEYWTGWREVSKPMAGLYAEQVSLANEGAAELGFENVSALWRGKYDM
PADEFPKELDRLWTQVEPFYESLHCHVRAKLGEHYGEDVVPQDKPIPAHLLGNMWAQSWG
NIYDIVKPQQEMKVPDVTGALAEQGYDEIAMVKQAESFFSSLGFEELPDTFWERSMFQKP
EGRDVQCHASAWDLDDKDDLRIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSA
NDGFHEAIGDTIALSITPKYLKQIELIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQW
RWKVMSGEVTPEQYNQLWWELREKYQGVMAPVERSADAFDPGAKYHVPANVPYTRYFLAH
ILQFQFHKALCDIAGDEGPLNRCSIYGSEEAGKALNEMLEMGMSQPWQNALETLTGSPQM
DASTIADYFAPLKTWLDEQNATRQCGW
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgctagagcatgtctatgtgaacgtcgattcacgtaaaaacacaataattaaaggacaa
agtatgctcaatcacaaacgtactctgatagcagcattggtaagcgtttcgcttatgggg
tgtggcgaaagtacaacacagacagaaactaaaccacaactcactgcacaagacgccaag
cagtttttaacacaggcgcaaaatgatattgcaaaaatgcaagttcctgccgcgcacgcc
gagtggagctacgccacgaatatcaatttcgatacagcagcagtcagtgcttactttaat
gaagtgctttctaccaaggttgcaaagttagctaaagaagcggcgaaatttaacgatgta
gacgtagatgccgacacccgcagacagcttgatctacttaaaaacagtttaacaatgccg
ccgccggcagatgccgaaaaagcagagaggcttgcaaaaattggttctgacttaagtgcc
atgtacggctctggtgagtattgcagcgaagatggtacgtgcaaaagcttggttgaaatg
agctctgaaatggccaccctacgcgatgctgacaagctactagaatattggacaggttgg
cgtgaagtttctaaacctatggctggactatacgcagaacaggtatcgctagcgaacgaa
ggtgctgcagagctaggttttgaaaatgtcagcgccttgtggcgtggaaagtacgatatg
ccagcagatgaatttcccaaggaattggatcgcttatggacgcaagtagagcctttctac
gagtcactacattgccatgtgcgcgctaagctaggtgaacactatggcgaagacgtagta
cctcaagacaaaccaatcccagcccatttattaggtaacatgtgggcacagtcgtggggg
aatatttacgatattgttaaacctcagcaagaaatgaaagttcctgatgttacaggcgca
ttagctgaacaggggtatgacgaaatcgccatggttaaacaagcagagtcatttttctca
tcgcttggctttgaagaacttccagataccttttgggaacgctctatgtttcaaaagcct
gaaggccgtgacgttcagtgtcatgcctctgcgtgggatttagatgacaaagacgatctt
cgtataaagatgtgtattcaaaagactggcgaagaatttaacgttattcaccacgaatta
ggtcacaactactatcaacgcgcttataaagaccaaccacttctttaccgtggttcggca
aacgacggcttccacgaggctattggcgacaccatcgctttatcaataacacctaagtac
cttaagcaaatcgagttaattgatgagatcccagacgcatcaaacgatatcggtatgtta
atgcaagttgcgttagacaagattgccttcattccctttggtctgatggttgaccaatgg
cgctggaaagtgatgtcaggtgaagtaacacctgaacaatataatcaactatggtgggaa
ttgagagaaaagtatcagggtgtgatggctcctgttgagcgcagcgccgacgcatttgat
ccgggtgcaaagtatcacgtgcctgctaacgtaccttatacacgctattttctagcgcat
atccttcaattccagttccataaagcactgtgtgacattgcaggtgatgagggcccgctt
aaccgctgttctatctacggcagtgaagaagccggtaaagcacttaacgaaatgctagag
atgggtatgagccaaccttggcaaaatgcgttagaaacactgacaggctcaccgcaaatg
gatgccagtactatcgctgactactttgcgccactaaaaacgtggttagatgagcaaaat
gctacacgccagtgtggctggtaa

DBGET integrated database retrieval system