KEGG   Alteromonas mediterranea UM4b: I636_08870Help
Entry
I636_08870        CDS       T02723                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amad  Alteromonas mediterranea UM4b
Brite
Enzymes [BR:amad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     I636_08870
Peptidases [BR:amad01002]
 Metallo Peptidases
  Family M2
   I636_08870
Exosome [BR:amad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I636_08870
CD molecules [BR:amad04090]
 Proteins
  I636_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AGQ01628
LinkDB All DBs
Position
complement(1987227..1989047)
Genome map
AA seq 606 aa AA seqDB search
MLNHKRTLIAALVSLSLIGCGESTTQTETQAALTAKDAKQFLQQAQDDIAKMQVPAAHAE
WSYATNINFDTAAVSAYFNEVLSTKVAKLAKEAAKFNDVDVDSDTRRQLDLLKNGLTMPP
PADAAKAERLAKIGSDLSAMYGSGEYCSEDGTCKSLVEMSSEMATLRDADKLLEYWAGWR
EISKPMAPLYAEQVELANEGAAELGFENVSALWRGKYDMPADEFPKELDRLWTQVEPFYE
SLHCHVRAKLGEHYGEDVVPQDKPIPAHLLGNMWAQSWGNIYDIVKPQQEMQVPDVTAAL
AEQGYDEIAMVKQAESFFSSLGFEELPDTFWERSMFQKPEGRDVQCHASAWDLDDKDDLR
IKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKYL
KQIDLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMSGEVTPDQYNDLWWEL
REKYQGVMAPVERSANAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPLN
RCSIYGSKEAGKALNEMLEMGMSQPWQNALETLTGSPQMDASTIADYFAPLKTWLDKQNA
TRQCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcataaacgtactctgatagcagcactggtaagcctatcgcttataggatgt
ggcgaaagtactacgcagacagaaacccaagcggcactgaccgcaaaagacgcaaaacag
ttcctccagcaagcacaagatgatattgcgaagatgcaggtacccgctgcgcacgcagaa
tggagctatgcgaccaatatcaatttcgataccgctgcggtaagcgcctactttaatgaa
gtgctatcaacaaaagtagcaaagttagccaaagaagcggccaaatttaatgatgtagat
gtggacagtgatacccgcagacaactcgatttattaaaaaatggcttaaccatgccacca
cctgcagatgcagctaaagctgagcgcttagccaagattggctctgacctaagtgccatg
tacggctcgggtgagtattgtagcgaagatgggacgtgcaaaagcttagtagaaatgagc
agtgaaatggccacccttcgtgacgccgataaattattagaatattgggcaggctggcgc
gaaatatctaaaccaatggcaccgctttacgcagaacaagtggagctggcaaatgaaggc
gcggcagagctgggttttgaaaatgtgagtgcactgtggcgcggcaaatatgatatgcct
gctgatgagtttcccaaagagctagaccgcttgtggacgcaagtagaacctttttatgaa
tcacttcattgtcatgtacgcgcaaagcttggtgaacattacggtgaagatgtagtacct
caagacaaacccattccggcccaccttttaggcaatatgtgggcacagtcgtggggtaac
atttacgatatcgtaaaacctcaacaagaaatgcaggtaccagatgtaaccgctgcgttg
gctgaacaaggctatgacgaaatcgctatggttaaacaggctgaatcatttttctcatcc
ctaggctttgaggaactgccagatacgttctgggaacgctctatgtttcaaaaaccagaa
ggccgtgacgtacaatgccatgcttctgcgtgggatttagatgacaaagacgaccttcgc
ataaaaatgtgtattcaaaagacaggcgaagagttcaacgttattcaccatgaattaggt
cacaactattatcagcgcgcctataaagatcagccactgctctatcgcggttcagctaac
gacggtttccatgaagcgattggcgacactatcgcactatcaattacgcctaaatacctc
aaacaaattgatttgattgatgaaatcccagatgcgtcgaatgatatcggcatgttgatg
caggtagcgcttgataagatcgcgtttattccttttggtttaatggttgaccaatggcgt
tggaaggtgatgtcgggggaagtaacacctgaccaatacaatgacctgtggtgggagctt
cgagagaagtatcaaggtgtgatggcacctgtcgagcgaagtgcaaatgcctttgaccca
ggtgcaaagtatcatgtaccagcaaatgtaccctacacgcgctatttcctagcgcacatc
cttcaattccagttccacaaagccttgtgtgatatagctggtgatgaaggcccgctaaat
cgctgctctatttacggcagtaaagaagccggtaaggcgctaaacgagatgctggaaatg
ggcatgagtcaaccgtggcagaacgcgttagagacactaacgggctcgccgcaaatggat
gctagcaccattgctgattacttcgcgccgctcaaaacgtggttagataagcaaaatgcg
acacgccagtgcggttggtag

DBGET integrated database retrieval system