KEGG   Alteromonas mediterranea UM4b: I636_15540Help
Entry
I636_15540        CDS       T02723                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amad  Alteromonas mediterranea UM4b
Pathway
amad00052  Galactose metabolism
amad00511  Other glycan degradation
amad00600  Sphingolipid metabolism
amad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I636_15540
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    I636_15540
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    I636_15540
Enzymes [BR:amad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I636_15540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1
Motif
Other DBs
NCBI-ProteinID: AGQ02944
LinkDB All DBs
Position
3490115..3492832
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTLLLLATNVTAKQREKIDFTGEWRFYRYADNQTPDSLIYDTRPNVNQ
FDDSQAADTRPSDAVTVNSHDGVLKSWILPTGNAFIANPDKRHVRPEGEPGKDFPFVQRA
FDDSHWKVANLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLAKDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWLEKTAQIHISQWGTQVITPTVSKDKATISITTSIRNHTKNDQNVSLQHHIY
ELSKQDTLSENPVLTLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEEGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFENTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WSGREGEITPVHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEVVTYKN
GKRWATDSVTTSGVPSGLRLSADRNIINADGKDLSFVTVDIVDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFCGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattaggaattataagggactacttgcccttaccttgctactgttagccaca
aatgttacagccaagcaacgagaaaaaattgattttactggagaatggcgattttaccgc
tacgccgataatcaaacgcctgatagcttgatttacgatactcgccccaacgttaaccag
tttgacgacagccaagcggcggatactcgcccttccgatgcggtaacagttaatagccac
gatggcgtattaaaatcctggattcttcccacgggaaatgcgtttattgctaaccccgat
aagcgccatgtaagacccgaaggcgaaccaggcaaagattttccatttgttcagagagcg
ttcgatgacagccattggaaagtggcgaatttacctcacgactgggccatcgcagggcca
ttctatagtggcaacaatcctaaagtggggggcggtatgggacgtctaccctcccacgga
gtagcgtggtatagaaagcagtttacgcttgctaaagacgataaaaacaaacgtatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggctaaatggtcatcttgtcggg
ggttggccttatggttatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggtggcggtatctatcgaaatgtatggttagaaaaaaccgcacagatccatatcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccacgatatcgattacc
acatcaatcagaaatcatacgaaaaatgatcagaacgtgagtcttcaacaccatatttat
gagctttcaaagcaagatacccttagcgaaaatccggtattaacgcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagctacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaacggaaaaacacttgaccaatacaccacgcccttcggcgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggctgcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacgttaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagaaggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccctacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgaatttgaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgcgccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcg
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctggccagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccggcatgatcgatctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcatattcttccccattggaat
tggtccggtagagagggagaaatcactcctgttcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcacaagggaagaaaaagaaaggtccctttgaatatcga
cttcgctttgatgatgttcgctacacgccgggaacagtagaagtggttacctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgtcccctcaggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcgtagataaaaaggggaatccagtaccgactgcgactcaccgcgttcacttttcgctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgagaggaaggcgttttgtggaaagctacttgttatcattcaaagtgagcac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system