KEGG   Alteromonas mediterranea UM4b: I636_17870Help
Entry
I636_17870        CDS       T02723                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amad  Alteromonas mediterranea UM4b
Pathway
amad03030  DNA replication
amad03410  Base excision repair
amad03420  Nucleotide excision repair
amad03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    I636_17870
   03410 Base excision repair
    I636_17870
   03420 Nucleotide excision repair
    I636_17870
   03430 Mismatch repair
    I636_17870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:amad03032]
    I636_17870
   03400 DNA repair and recombination proteins [BR:amad03400]
    I636_17870
Enzymes [BR:amad01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     I636_17870
    6.5.1.6  DNA ligase (ATP or NAD+)
     I636_17870
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     I636_17870
DNA replication proteins [BR:amad03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    I636_17870
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     I636_17870
DNA repair and recombination proteins [BR:amad03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     I636_17870
   NER (nucleotide excision repair)
    Other NER factors
     I636_17870
   MMR (mismatch exicision repair)
    Other MMR factors
     I636_17870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase mRNA_cap_enzyme Mei5
Motif
Other DBs
NCBI-ProteinID: AGQ03398
LinkDB All DBs
Position
4048694..4050382
Genome map
AA seq 562 aa AA seqDB search
MEAFSNLLEQLYYTAGTKAKAQLIADYIANTPDPDRGWAIAAMAGTLRFDFFKRNTVKKL
ITEHTDPALFAMSYDYVGEVSETVAHLWPHSEPTDSLPSLTEVVETFASVSKQKVSDTLA
HYLTIMTPAQRWALLKLGTRGLRIGVSARSIKQILADYGNKDIKDIETLWHAVTPPYVDM
LSWLEGKADKPDIENAVTFHPVMLSHPIEDSDIDAFTKDTWQIENKYDGIRVQLAVKTGK
VSDENEPDKALFSRTGDDISHSFPDLLESVNGNMVLDGELLVIHNAENDQGSKKRGEAST
KTHDDSGATQSNAALQPDVDTFNTLQQRLNKKKPSKALQTSAPVGLIVYDALVLNGEDLT
EKTLKARRQALEKWFSENSNNRLFLSETLTATSPQSLRKLHAQVCQNRAVEGLMIKRLDS
KYIPGRPKGKWFKWKRDPLVVDAVMMYAQRGHGKRSSFYSDYTFGAWEDNQLLPIGKAYS
GFTDEELKKLDNWVRRNAVGRFGPVREVKKELVLEVAFDAAHPSSRHKSGVALRFPRIHR
IRWDKPADEADTLANVKALIEQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcattcagtaacttacttgaacagctttattacaccgctggaaccaaggcaaaa
gcgcagcttatcgctgactacattgccaatacgccagaccctgaccgcggctgggccatt
gccgctatggcaggcacgctgcgcttcgattttttcaagcgtaatacggtaaagaagctt
attaccgaacacaccgaccccgccctttttgccatgagctacgattatgtcggtgaagtt
agcgaaaccgtggcccatttatggccgcatagcgagcctacagactcgcttccaagcctt
acggaagtggtagaaacgtttgcgtcggtgagtaagcaaaaggtgtctgacaccttggcc
cattatctaaccataatgacccctgcccagcgctgggcgttactgaaactagggacgcgc
ggtctgcggataggcgtgtcggcccgctctattaaacaaatactcgcagattacggcaac
aaagatatcaaggacattgaaaccttatggcacgcggtaaccccgccctacgtggatatg
ctttcatggctagaaggcaaagccgataaacccgatattgaaaacgcggttacctttcac
ccggtgatgctttctcaccctattgaagatagcgacattgacgcattcactaaagacaca
tggcaaattgaaaacaagtacgacggtattcgcgttcagcttgcggttaaaacaggtaaa
gtgtctgacgaaaacgagcctgacaaagcgctattttctcgtacgggcgacgatatcagt
cattcgttccccgatttactagagtccgtaaacggtaatatggtgctagacggtgaactc
ctggtaattcataacgcagaaaacgaccaaggctcaaaaaagagaggcgaagctagtaca
aaaactcacgatgacagcggtgctactcagagtaacgctgccttacagccggatgtggac
acctttaacacccttcagcagcgccttaataagaaaaaaccaagcaaagcgctacaaact
tctgctcctgtagggctcattgtgtacgacgccttagtgcttaatggtgaggatctcact
gaaaaaactttgaaagctcggcgccaagcccttgaaaagtggtttagcgaaaatagtaac
aaccgtttgtttctatcagaaacccttaccgctacctcccctcaaagccttcgcaagctt
cacgctcaagtttgtcaaaaccgtgcagttgaagggctgatgataaagcgccttgatagt
aagtacattcccggccggccgaagggtaagtggtttaaatggaagcgcgatccgctggtt
gttgacgcggttatgatgtacgcgcagcgggggcacggaaaacgttcaagcttctattct
gattacacctttggcgcatgggaagacaaccagctactgcctattggaaaagcgtactcc
gggttcactgacgaagagcttaagaagcttgataattgggtaagacgcaatgccgtcggc
cgctttgggccagtaagagaagtaaaaaaagaactggtgcttgaagtggccttcgacgca
gctcacccttcatcaagacataaatcgggcgtcgcgctgcgctttcctcgcattcaccgt
attcgctgggacaagcccgctgatgaagctgacacgctagccaatgtgaaagccttgata
gagcaatga

DBGET integrated database retrieval system