KEGG   Alteromonas mediterranea U7: I876_03035Help
Entry
I876_03035        CDS       T02721                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00071  Fatty acid degradation
amae00280  Valine, leucine and isoleucine degradation
amae00281  Geraniol degradation
amae00310  Lysine degradation
amae00362  Benzoate degradation
amae00380  Tryptophan metabolism
amae00410  beta-Alanine metabolism
amae00640  Propanoate metabolism
amae00650  Butanoate metabolism
amae00903  Limonene and pinene degradation
amae00930  Caprolactam degradation
amae01100  Metabolic pathways
amae01110  Biosynthesis of secondary metabolites
amae01120  Microbial metabolism in diverse environments
amae01130  Biosynthesis of antibiotics
amae01200  Carbon metabolism
amae01212  Fatty acid metabolism
Module
amae_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    I876_03035 (fadB)
   00650 Butanoate metabolism
    I876_03035 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I876_03035 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I876_03035 (fadB)
   00310 Lysine degradation
    I876_03035 (fadB)
   00380 Tryptophan metabolism
    I876_03035 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I876_03035 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I876_03035 (fadB)
   00281 Geraniol degradation
    I876_03035 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I876_03035 (fadB)
   00930 Caprolactam degradation
    I876_03035 (fadB)
Enzymes [BR:amae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     I876_03035 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     I876_03035 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     I876_03035 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     I876_03035 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 5_3_exonuc_N
Motif
Other DBs
NCBI-ProteinID: AGP88492
LinkDB All DBs
Position
complement(709165..711315)
Genome map
AA seq 716 aa AA seqDB search
MIYTGKSLSVSLLDDGFAELVFDAEGSVNKFDRQTVSELDEATQALLAKGDVKGLVVRSA
KPAFIVGADITEFTGLFTMDDAEVLQWVANTSQVFDRFEDLPFPTIAAVNGFALGGGCEM
ALACDMRIADTTASIGLPEVKLGLMPGFGGTVRLPRLIGADNALEWMTTGRDRKGAKALA
EGAVDAVVAPEALVEGALSMVKDAAEGKFDWQARRAVKKAPLQLNKNEAMMSFSTAQAMV
FAQAGKHYPAPHKMVETVQKAAGLDRDGALKLENEGFVALAKTDAAKAQIGIFLADQLVK
SKGKKQAKAATKQSKLNAVLGAGIMGGGIAYQSAVKGTPVIMKDINQGALDLGLSEAAKI
LGKGMKRGKVDATKMAQTLNAITPTLEYSTLKDADLVIEAVVENPKVKGIVLKEVEDNVA
DDAIITSNTSTISINQLAKSLDKPERFCGMHFFNPVHRMPLVEIIRGEKTSEETINAVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLLIDGADFVAVDKVMEKIFGWPMGPAY
LMDVVGIDTGDHAADVMAAGIPERMARLDNDPVTLFYKEERLGQKNGKGFYNYGVDKRGK
PKKTPAEEAYALMAPHVAEKTDFEADDIIARLMIPMANEAIRCLEEGIVDSAAEADMALL
YGLGFPPFRGGIFRWIETIGLANFVAMADKYAELGPIYQISDGVREMAASGKSYFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaggcaaaagtctttccgtcagcctgttagatgacggctttgctgagctg
gtattcgacgccgaaggttcagtaaacaagttcgaccgccaaacagtgagcgaacttgac
gaagcaacccaagccctacttgctaaaggcgatgtaaaaggcttagtagtacgcagtgca
aaacctgcatttatcgtaggtgcagatatcaccgagttcactggtcttttcactatggac
gatgctgaagtactacagtgggttgccaatacgtcacaagtattcgaccgcttcgaagac
ctacctttccctaccattgctgctgttaatggctttgcgctaggtggtggttgtgagatg
gcattggcgtgtgacatgcgtattgcagacacaacagcttcaatcggtttaccagaagtt
aagctaggccttatgcctggttttggtggcacggttcgccttcctcgcttaataggtgca
gataacgcccttgagtggatgactactggccgtgacagaaaaggcgcgaaagcccttgct
gaaggcgcggttgatgccgttgttgctccagaagcacttgttgaaggcgcactttcaatg
gtgaaagacgctgcagagggcaagtttgactggcaagctcgtcgtgcggttaagaaagcc
ccactacagctaaacaaaaacgaagctatgatgagcttcagtactgctcaagccatggta
ttcgcgcaagctggtaagcattacccagctccgcacaaaatggttgagacggtacaaaaa
gcagcgggcctagaccgtgacggtgcacttaagcttgaaaacgaaggctttgtggccctt
gcgaaaaccgacgcagcgaaagcacaaatcggcattttccttgccgaccagctagttaag
agcaaaggcaagaagcaagcaaaagcagccactaagcagtctaagcttaacgctgttcta
ggtgcaggcatcatgggcggcggtattgcataccaaagcgcagtgaaaggcacaccggta
attatgaaagacattaatcaaggtgcactagaccttggtctttcagaagcggccaaaatt
cttggtaaaggtatgaagcgcggtaaagttgatgcgactaaaatggcgcaaacgcttaac
gcaattacacctacccttgagtacagcacgcttaaagatgcagaccttgttattgaagcg
gttgtagaaaacccgaaagtaaaaggtattgtacttaaagaagtagaagacaatgtagcg
gacgacgctatcatcacttcaaacacttctactatctctatcaatcagctagctaaaagc
ttagacaagccagagcgcttctgtggtatgcacttcttcaacccagtgcaccgcatgccg
cttgttgaaattattcgtggcgaaaaaacgtcagaagaaaccatcaatgcagtagtagcc
gctacccttaaaatgggcaaaacccctattgtggttaatgactgcccagggttcttggta
aaccgcgtattgttcccatactttgcgggcttcagtaagctacttatcgacggcgctgac
tttgttgctgttgataaagtaatggaaaaaatcttcggctggccaatgggcccggcttac
ctaatggacgttgtaggtatcgacacaggcgatcatgcagcagacgtaatggcagcaggt
attccagagcgtatggctcgcctagacaacgacccagtaaccctgttctacaaagaagag
cgtttaggtcagaaaaacggtaaaggtttctacaactacggtgttgataagcgcggtaag
cctaagaaaacacctgctgaagaagcatatgcactaatggcgccccacgtagctgagaag
acagactttgaagctgacgacattattgcacgccttatgatccctatggcaaacgaagca
attcgctgcctagaagaaggcattgtagatagcgcagctgaagcagacatggcgctactt
tacggcttaggtttccctccattccgcggtggtattttccgttggattgaaaccattggc
ttggcgaactttgttgctatggcagacaagtacgctgaacttggtccaatttatcagatt
tcagatggcgttcgtgaaatggccgcttctggtaaatcctatttcgcataa

DBGET integrated database retrieval system