KEGG   Alteromonas mediterranea U7: I876_09495Help
Entry
I876_09495        CDS       T02721                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00020  Citrate cycle (TCA cycle)
amae00190  Oxidative phosphorylation
amae00650  Butanoate metabolism
amae01100  Metabolic pathways
amae01110  Biosynthesis of secondary metabolites
amae01120  Microbial metabolism in diverse environments
amae01130  Biosynthesis of antibiotics
amae01200  Carbon metabolism
Module
amae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amae_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I876_09495 (sdhA)
   00650 Butanoate metabolism
    I876_09495 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I876_09495 (sdhA)
Enzymes [BR:amae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I876_09495 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     I876_09495 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGP89760
LinkDB All DBs
Position
2150877..2152649
Genome map
AA seq 590 aa AA seqDB search
MSLPVHEFDAVVIGAGGAGMRAALQISESGKSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKIYQRPFG
GQSKNFGGEQGARTAAAADRTGHALLHLLYQQNVKNKTKVFSEWYALDLVKNQDGDVVGC
TAIDIESGEVVYFKSRAVVLATGGAGRIYASTTNAHINTGDGVGMALRAGVAVQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCEGPWGTHIKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTNVDGQCLTVDENGNDKVVNGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
KTLSDMAPTRDASESDLEASMARFNRWENSEKGKGEDPVQIKKDLQECMQLNFSVFREGD
AMAEGLKELSEIRERLKNARLDDKSSDFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDDNWLCHSIYDPNTDKMIKREVNMAPKLREAFPPKVRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccgttcacgagtttgatgcagtagtaattggtgccggcggtgcaggtatg
cgcgcagcactccagatttcagagtctggtaaatcttgcgctctgctttcaaaagtattt
ccaacccgttctcacactgtgtctgcacaaggtggtattaccgtagcattgggtaattca
cacgaagacaactgggaatggcacatgtatgacaccgtaaaggggtcagattatatcggt
gaccaagacgctatcgaatacatgtgtaagacaggacctgaagcaatcattgagatggag
aacatgggtcttcctttctctcgcttcgaaaacggtaaaatttaccagcgtccttttggt
ggtcagtctaagaactttggtggcgagcagggtgctcgtacggcagcagcggctgaccgt
accggtcacgcacttcttcaccttctttaccaacaaaacgtaaagaataaaacaaaagta
ttttctgagtggtacgcgctagatttagtgaaaaaccaagacggtgacgtagtaggttgt
acagcaatcgacatcgaatctggcgaagtagtttacttcaagtcgcgcgctgttgtactt
gcaacgggtggtgcagggcgtatctatgcgtctaccacaaacgcacacatcaataccggt
gacggtgtgggtatggcgcttcgtgcaggtgttgcagttcaggatatggaaatgtggcag
ttccacccaacgggtattgctggcgcaggtacattggttactgaaggttgtcgcggtgaa
ggtggttacctactaaacaaagacggcgagcgcttcatggaacgttatgcgccaaacgcg
aaagaccttgctggtcgtgacgttgttgcgcgttcaatgatgacagagattcgcgaaggt
cgcggttgtgaaggcccatggggtacacacattaagcttaagcttgatcaccttggtaaa
gacgttcttgaatcgcgtctacctggtatccttgagctatcccgtacgtttgcacacgtt
gacccagtaaaagagccaattccagtaattcctacttgtcactatatgatgggtggtatt
ccaactaacgttgatggccaatgtctaacggttgatgaaaacggtaacgacaaggttgtt
aatggtctatttgcttgtggtgagattgcttgtgtatcggtacacggcgctaaccgcctt
ggcggtaactcgctacttgaccttgttgtattcggtcgtgcgactggcttacaccttggt
aagacattatctgatatggctccaacgcgcgacgcgtcagaatctgatcttgaagcgtca
atggctcgtttcaatcgttgggaaaattcagaaaaaggcaagggcgaagacccagtccaa
attaagaaagatttgcaagaatgtatgcagcttaacttctcggtattccgtgaaggtgac
gcaatggcggaaggacttaaagagcttagcgaaattcgtgagcgcctcaagaatgctcgc
cttgacgacaagagttcagacttcaatacccaacgtatagagtgtttagaacttgataac
cttatggaaaccgcgtacagcacggcagtagcagcgaacttcagaacggaaagccgtggt
gcacacagccgcttcgacttcccggaccgagatgatgataactggctatgtcacagcatt
tatgatccgaacacggataaaatgattaaacgtgaagtgaatatggcgcctaagcttagg
gaagcattcccgcctaaagtgcgttcatattaa

DBGET integrated database retrieval system