KEGG   Alteromonas mediterranea U7: I876_11195Help
Entry
I876_11195        CDS       T02721                                 

Definition
(GenBank) acyl-CoA dehydrogenase-like protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00071  Fatty acid degradation
amae00280  Valine, leucine and isoleucine degradation
amae00410  beta-Alanine metabolism
amae00640  Propanoate metabolism
amae00650  Butanoate metabolism
amae01100  Metabolic pathways
amae01110  Biosynthesis of secondary metabolites
amae01120  Microbial metabolism in diverse environments
amae01130  Biosynthesis of antibiotics
amae01200  Carbon metabolism
amae01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    I876_11195
   00650 Butanoate metabolism
    I876_11195
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I876_11195
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I876_11195
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I876_11195
Enzymes [BR:amae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     I876_11195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M AcylCoA_DH_N Acyl-CoA_dh_N Acyl-CoA_dh_2 DUF2066 LINES_N
Motif
Other DBs
NCBI-ProteinID: AGP90092
LinkDB All DBs
Position
complement(2529164..2530966)
Genome map
AA seq 600 aa AA seqDB search
MADQLIPRREMQFQLYEVLNTASLCEKSRFEEHNVETFNAVIDMAEKMAEELFLPHNAVA
DKNEPTFDGSKVSMIDEVKVAFDTYRESGFIAGHFDFEDGGMQLPVTVMNACAGYFLAAN
PSSTAYPFLTAAAANVIKHFASSDIKNAFLPKMLTGDFTGTMALTEPHAGSSLADIRTSA
KPQDDGTYRIKGSKIYISGGEHELSDNIVHLVLAKIPGGPAGVKGISLFAVPKYRLDADG
NPDVRNDVTLAGLIHKMGYRGTTSTALTFGENGDCHGYLIGEPHQGLRYMFMMMNEARIG
VGYGAAMIGYRGYRYSLEYAKDRTQGRAAPNLAPEDDPSPIINHGDVRRMLLAQKAYCEG
GMSLCLYGSMLIDKMETETDSEKRTELSQLLDLLTPVFKAWPSEFGPKANDLAIQILGGA
GYTREYPVEQCWRDNRLNPIHEGTNGIQALDLLGRKLWQHDGKGLEALLSRVTGDMKRAE
TPRAQTLAAKLKPYLDKLGALIQQAATDLRSDKQPVLLTNASCFLNIFSSCVVSWIWLRQ
ANVAEQALAKGADEQDVDFYEGKLAAAEYFLNWELPLVSRDIEVLTSQDATCNNVKASYF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcaacttattcctcgccgtgaaatgcaattccaattgtatgaggtattaaat
accgcatcgctctgcgaaaaatcacgctttgaagaacataacgtagaaacattcaacgct
gttattgatatggctgagaaaatggctgaagagctatttcttcctcacaatgcggtggct
gataaaaatgagcctacgtttgatggttcaaaggtttcgatgatcgatgaggttaaagtc
gcgtttgatacgtaccgtgaatctggtttcattgccgggcactttgattttgaagacggc
ggcatgcagctacccgttacggtaatgaatgcctgtgcgggttactttttagcggctaac
ccatcatctacagcttatccgtttctaaccgcagcggctgcaaacgtcattaagcatttt
gcttctagcgatatcaaaaatgcgttcctgccaaagatgcttacaggtgacttcacagga
accatggcattgacagagcctcacgcgggttcttcacttgctgatatccgcacttcagcc
aaaccgcaagatgacggtacttaccgcatcaaaggtagcaagatttatatttcaggcggt
gagcatgagctatctgacaatatcgtgcatttggtgctggcgaagataccaggtggtcct
gcaggcgtgaaaggtatttcacttttcgctgtacctaaataccgtttagatgcagacgga
aatccagatgtgcgcaatgatgttacccttgcgggccttattcacaaaatgggctaccgc
ggtactacatctacggcacttacgtttggcgaaaacggtgattgccacggctatcttatt
ggcgagcctcatcaaggtttgcgttatatgttcatgatgatgaacgaagcgcgtattggc
gtgggctacggtgctgccatgatagggtatcgcgggtaccgctattcattggaatacgca
aaagatcgcacccaaggccgtgctgctcctaacttagcgccagaagatgacccgtcacct
attatcaatcatggcgacgtgcgccgaatgttactcgcgcaaaaagcctactgtgaaggt
ggtatgtcgctttgcctgtatggcagcatgctgatagacaaaatggaaaccgagacggat
agtgaaaagcgtaccgagctttcccagctgttagacctattaacgccggtgtttaaagcc
tggccatcagagtttggtcctaaagcgaatgacttagctattcagattttggggggcgcg
ggttatacccgtgaataccctgttgagcaatgctggcgtgacaaccgcttaaaccccatt
cacgaggggactaatggtattcaagcacttgacctgcttggtcgaaaattgtggcaacac
gacggtaaggggctagaggcgttgctttctcgtgtaacgggcgacatgaagcgtgcagaa
acgccacgtgcacagacacttgccgctaagctaaagccttacctagacaagctaggggca
cttattcaacaagctgccaccgatttgcgttcagacaaacaaccggtattgcttactaac
gcaagctgctttttaaatatattctcaagttgtgtagtgagctggatttggctgcgccaa
gcgaatgttgccgaacaagcactcgcgaaaggggcagacgaacaagacgttgacttctac
gaaggcaagttagcagccgccgagtattttttaaattgggaactgccgctggttagtcgc
gacatcgaagtactcacgtcacaagacgccacatgtaataacgttaaagcgagctatttc
taa

DBGET integrated database retrieval system