KEGG   Alteromonas mediterranea U7: I876_14685Help
Entry
I876_14685        CDS       T02721                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00473  D-Alanine metabolism
amae00550  Peptidoglycan biosynthesis
amae01100  Metabolic pathways
amae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    I876_14685
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I876_14685
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    I876_14685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amae01011]
    I876_14685
Enzymes [BR:amae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I876_14685
Peptidoglycan biosynthesis and degradation proteins [BR:amae01011]
 Precursor biosynthesis
  Amino acid ligase
   I876_14685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A ATPgrasp_ST ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AGP90784
LinkDB All DBs
Position
complement(3334723..3335691)
Genome map
AA seq 322 aa AA seqDB search
MFKPSVSTHSPEKYGKVAVLLGGDSAEREVSLNSGNAVLNALLRQGVNAFAFDPAERPLN
DLLSLDVDRALIMLHGRGGEDGAMQGALQFLKIPYTGSRVLGSALAMDKIHTKQVWQSLG
LPTAKYEIADKRHFEAGKCSAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLETAIQDAF
KYDNQVLLEQYIDGPEFTVSVIQGQALPSIRMSTPHTFYDYAAKYQDNTTEYYCPSGLSE
EQEAQLAKLASRAFDAISGSGWGRIDVMQDNQRQFYLLEANTVPGMTEKSLVPKAAKVAG
LTFDELVLSILSTSFDDVANKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccttcagtaagtacacactcacctgaaaagtatgggaaagtagctgtactt
ttaggtggtgactcggccgagcgtgaagtatcgctaaattcggggaatgcggtgctaaac
gcactgttaagacaaggggtaaatgcatttgcctttgaccccgcagagcgcccacttaac
gatttgctgtcgctagatgttgatagagccctcattatgcttcacggtcgcggcggtgaa
gatggcgctatgcagggggctcttcagtttttaaaaataccctacacgggaagccgagtt
ttaggctcagcgctggcgatggacaaaattcatactaagcaagtgtggcaaagtttaggt
ttacccactgcaaaatatgaaattgctgataaaaggcactttgaagctggtaagtgcagc
gctataatggataaattagggaatgaagtcatggtaaaaccggccagagaagggtcgagt
attggcatggcgagagtgacaagcgctaaacagctcgaaactgccattcaggacgctttc
aaatacgataatcaagtcctgttggagcagtacatagacggccctgaatttactgtttct
gtgatacaggggcaggcgttgccgtctattcgcatgtctactccacatacattctatgat
tatgctgcgaaatatcaggataatacaacagaatactattgcccaagcggtttgtctgaa
gagcaagaagcacagcttgcaaagttagcttctcgtgcgtttgatgctatttctggcagc
ggttggggcagaattgatgttatgcaggacaatcaaaggcagttttatttgctagaggca
aatacagtgcctggcatgacagaaaaaagtttggtgcctaaagcggccaaagttgcaggc
ttaacgtttgacgagttggtgttgagtattctttcgaccagctttgatgatgttgcaaat
aaggcgtag

DBGET integrated database retrieval system