KEGG   Alteromonas mediterranea U7: I876_14895Help
Entry
I876_14895        CDS       T02721                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00330  Arginine and proline metabolism
amae01100  Metabolic pathways
amae01110  Biosynthesis of secondary metabolites
amae01130  Biosynthesis of antibiotics
amae01230  Biosynthesis of amino acids
Module
amae_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    I876_14895
Enzymes [BR:amae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     I876_14895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH NAD_binding_2 NAD_Gly3P_dh_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGP90826
LinkDB All DBs
Position
3379963..3380784
Genome map
AA seq 273 aa AA seqDB search
MQQKKLAFIGAGNMSRSIISGLIKSGYAKENILAANPSTPKLDGLKAEFGIHTTQSNDEA
CQFADAIVLAVKPQIMGDMCGELQKNNDLSGKLFLSIAAGLPVARLQEMLGGEYPVVRIM
PNTPSLLGKGMSGMYADSTVSEADRQYVDDVMNSVGETVWVNEEAGINGVIAAAGSSPAY
FFLFLQNMQEEAMNMGFDKEQSRLMVQQAMLGAAEMVCNNPDLELSELRAQVTSKGGTTA
EAVNTFINEGLKDIVSKSMRAAVARADEMAKQL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagaaaaaattagcatttattggcgcgggcaatatgagccgcagcatcatcagt
ggtcttatcaaatctggatatgcaaaggaaaatattcttgctgccaacccatcaacgccc
aagcttgatggcttaaaagccgagtttggtattcacaccacacagtcaaacgatgaagcc
tgccaattcgctgatgccattgtgcttgcggtaaaaccacaaattatgggtgatatgtgc
ggcgaactgcaaaagaataacgatctatcgggtaagttattcttaagcattgcagccggt
ctacccgttgcacgattgcaagaaatgctgggcggtgaataccctgttgttcgcattatg
ccaaatacaccaagtttgctaggtaaaggcatgtcgggtatgtatgccgatagcacagtt
tctgaagcagacagacaatatgttgacgatgtgatgaacagcgttggcgaaaccgtttgg
gtaaatgaagaagcgggcattaatggtgtgattgccgcagcgggcagtagcccagcgtat
ttcttcttgttcttacaaaacatgcaagaagaagccatgaacatgggctttgacaaagag
caatcgcgcttaatggtgcagcaagcgatgctcggtgcagccgaaatggtttgtaacaac
ccagaccttgaattaagcgagcttcgcgcccaagttacgtcaaagggcggcacgacagca
gaagccgtcaacactttcattaatgaagggttaaaagacattgtcagcaagtcaatgcgc
gcagcagttgcacgtgctgacgaaatggcaaaacagctataa

DBGET integrated database retrieval system