KEGG   Alteromonas mediterranea U7: I876_16730Help
Entry
I876_16730        CDS       T02721                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amae  Alteromonas mediterranea U7
Pathway
amae00620  Pyruvate metabolism
amae00680  Methane metabolism
amae01100  Metabolic pathways
amae01120  Microbial metabolism in diverse environments
amae01200  Carbon metabolism
Module
amae_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I876_16730
  09102 Energy metabolism
   00680 Methane metabolism
    I876_16730
Enzymes [BR:amae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I876_16730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 T4_tail_cap DUF1383
Motif
Other DBs
NCBI-ProteinID: AGP91184
LinkDB All DBs
Position
3806211..3808832
Genome map
AA seq 873 aa AA seqDB search
MQTHYDAELKDTVRYLGKTLGETIKNQLGQEWLDRIEKIRKGGRASYQGDATCSEELKET
FKTMSDSDLLTVGRAFAQFLNLGNIAEQEYNAAMNVDASIDALFKHLDKAELTADKVQDA
VAKLNIDLVLTAHPTEVTRRTLIHKHKELADCLQAVHQESLSDVERKKVETRIADLIAQA
WHTEEIRSVRPTPVDEARWGFSVIENSLWEAVPDFMRELDGRLNEDYDVSLPLDSSPVQF
SSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFAIDLDRLQVELSMYDCNEELRDKVGD
ANEPYRALLRPLVNKFIATRDGIADYLAGKNPDTSNWIESDDELIEPLMLCYQSLIDCGM
QVVANGLLLDTIRRARVFGIHLLRLDVRQDSERHADVFSELTRYLGLGDYAQWSEADKQA
FLLRELGSKRPLFPAQWDASDDVKEVLDTCKVIAKHSKHGFGIYIISMASEPSDVMAVQL
LLQESGVDWPMPVAPLFETLDDLNNSPDVMRKLLSIDWYRGYVKGRQFVMIGYSDSAKDA
GALAAGWAQYQSQEALVAIAEEFDVSLTLFHGRGGTIGRGGLPAHAAIYSQPPGSLEGGF
RVTEQGETIRYKFGMPKLAKRSLGIYASAIIEAMLFPPPAPKEEWRELITTMAAQGRDNY
RATVRHDEEFVPYFRVATPEQELGKLPLGSRPAKRKPQGGIESLRAIPWIFAWAQTRLVL
PSWLGVMRAIDSVKTPENEKVVNEMFSEWPFYRSRLSMLDMVFHKADPRISEAYDERLVP
KELKHFGEALRSELKESISSLLAITGDDDIMKNDPQGKESMEIRAGYLQPLHYLQIELLD
RIRKAGDDAQNTSLERAMMVTIAGIAIGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacactacgatgctgaactgaaagataccgttcgataccttggtaaaaccctt
ggtgaaacaatcaaaaatcaattaggtcaggagtggctagaccggattgaaaagattcga
aaaggcggccgagcttcttatcagggagacgctacttgtagcgaagaactgaaagaaact
ttcaaaacaatgtctgacagcgatttgcttactgttggtcgtgccttcgcacaattcttg
aacctaggtaatattgccgagcaagaatacaacgcggcaatgaatgttgatgcatctatt
gatgcccttttcaaacacctagataaagcagaactaactgctgacaaagtacaagacgcc
gttgcaaaactaaacatcgatcttgtattaaccgcgcaccctactgaggttacgcgccgt
acacttattcataaacacaaagagctagcggattgcctgcaggctgtgcatcaagaatcg
ttaagtgatgttgagcgtaaaaaggtagaaacacgcattgctgaccttattgctcaagct
tggcacactgaagaaattcgttccgttcgcccgacccctgttgatgaagcgcgttggggc
ttctcggtcattgaaaactcattgtgggaagcggtacctgacttcatgcgcgagctagat
ggccgcttaaacgaagactacgacgtatcactaccgctagactcgtcaccagtacaattt
agctcttggatgggtggagacagagacggcaacccatttgttacttcaaaagtaactgag
caagtactgctgcttgctagaaagcgcgcggctaagcttttcgctatcgaccttgatcgt
ttgcaagtagaactttcaatgtacgattgcaacgaagaactacgtgacaaagtaggcgat
gcaaacgaaccgtaccgcgccctacttcgcccgctggtaaacaagtttattgcgactcgc
gatggcattgccgactacttggccggcaagaatccagacacgtctaactggattgaaagc
gacgacgagcttatcgagccgctaatgctttgctaccagtcattaatcgactgcggtatg
caagtagtggcaaacggccttctactagatactatccgtcgtgctcgtgtattcggtatt
caccttcttcgccttgacgtacgtcaagattctgagcgtcacgccgacgtatttagtgag
ctaactcgctacctaggtttaggcgactacgcccagtggagcgaagccgacaagcaagcg
ttcttattacgtgagcttggctcgaaacgtccgttattcccagcgcaatgggatgcatct
gacgatgtaaaagaagtgctagatacctgtaaggtgattgcgaaacacagcaagcacggc
ttcggtatttacattatctctatggcgagtgagccatcggatgtcatggcggttcagctg
cttcttcaagaaagcggtgtagactggccgatgccggtagcaccactatttgaaacgctt
gacgatttgaacaactcaccagatgtaatgcgcaaactcctgtctatcgactggtatcgc
ggttacgtgaagggccgtcagttcgttatgatcggttactctgattcagcgaaagatgca
ggcgcattggctgctggctgggcacagtatcagtcgcaagaagcattggttgccattgca
gaagaattcgacgtaagcctaaccctgttccacggacgtggcggtacgattggtcgtggt
ggattgccagcacatgcggcaatttactcacagcctcctggctcactagaaggcggtttc
cgcgtaacagaacagggcgaaactattcgctataagttcggtatgccaaaactggctaaa
cgcagcctaggtatttacgccagcgccattattgaagccatgttgttcccacctccggca
ccaaaagaagagtggcgtgagcttattaccaccatggcagcgcaaggtcgtgataactac
cgtgcaactgtacgtcacgatgaagagtttgtaccttacttccgcgtggctactccagag
caagagctaggtaaactacctctaggcagccgccctgctaagcgtaaaccacaaggcgga
attgagagcttacgtgctatcccatggatcttcgcttgggcacagacacgtttagtgctg
ccaagctggttgggcgttatgcgcgctattgatagcgtgaagactcctgagaacgagaaa
gtggttaacgagatgttcagcgaatggccgttctatcgttcacgcctttctatgttagac
atggtgttccacaaagctgacccacgcattagcgaagcttatgatgagcgcttggtaccc
aaagaacttaaacactttggtgaagcattgcgtagcgagcttaaagaaagcatctcttca
ctgctggctatcacaggcgatgacgacattatgaagaacgacccgcagggtaaagaatcg
atggagatccgcgcaggataccttcagccacttcattaccttcaaatcgagcttcttgat
cgtattcgtaaagccggtgatgacgcacaaaacaccagcctagagcgcgccatgatggta
accattgccggtattgctatcgggatgcgtaacacgggttaa

DBGET integrated database retrieval system