KEGG   Alteromonas mediterranea MED64: I533_02050Help
Entry
I533_02050        CDS       T02958                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I533_02050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:amag01003]
    I533_02050
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amag01011]
    I533_02050
Enzymes [BR:amag01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     I533_02050
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     I533_02050
Glycosyltransferases [BR:amag01003]
 Polysaccharide
  Bacterial polysaccharide
   I533_02050
Peptidoglycan biosynthesis and degradation proteins [BR:amag01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   I533_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter CrgA
Motif
Other DBs
NCBI-ProteinID: AGP80405
LinkDB All DBs
Position
450830..453190
Genome map
AA seq 786 aa AA seqDB search
MTKRQTKNNSSSKSNASKKTAAGKSTTKRSWFFKLFWRVCLIGLVVLGAYAFYLDAQIKH
AFSGNKWEVPAQIFARPLEVSKGEEITPQEVIDELNLLGYRKVAFADSSGEYSYQNKVLT
VQRRAFQFPEGAEPLRHLVLTWEGARIGEIYDKSQGRPYGSVKLEPWLVTRMTSGSHEDR
MLVTLDTIPEMLPKALTLVEDRNFYNHHGVAPLSILRALMANIAAGRTVQGGSTLTQQLV
KNMFLTRERSLVRKAKEAIMAVIIDARYSKSEIIEAYLNEVFLGQNGDMAVHGFGLASYF
YFDRPANELSTPEIATLVAIIKGPSYYNPRKYAERTKERRDLVLRMLFDENEINRQDYER
YVNMPLGLASGASLASGKHPAFMEQVRKELNEILAEPSLRDSGVKVFTTLDIVAQRRAEK
ALSSTLNGLQKDRSVPLQGAMVVTDSASGEVRAIVGGKDFAFKGFNRALDAKRPIGSLIK
PAVYLTALEDPTQFNLATPLKDEPITLESRNGTEWSPQNYDKEFRGQVPLLQGLVESLNV
PTVNLGMQIGLDALADTIERLGVTTPVDKVPSLTLGAFELTPFSTNQMYQTLSNDGRYIP
LHTVSSVVTADNALLWKKAEFFAQRTDEAATYLLNYALYKVTTEGTAKRIGWNFGNVNMA
GKTGTTDDYRDSWFSGFDRNNVVTVWVGNDDNQPVNLTGAGGALPVFVNYMKSQSPKSLS
RRFPKGLGIAHFDAKTGAVVVAGCAGSLSVPAILDVLPPAQQDCAGRPVDENGDKKEKSW
WERIFG
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaagacagactaaaaacaattcatcttcaaaaagcaatgcttcgaaaaaaact
gcagcgggaaaaagtacaaccaaacgttcgtggttttttaaactgttctggcgtgtatgc
cttatagggcttgtggtgctaggggcatatgccttttatctcgacgcacaaattaaacat
gcgttctcgggtaacaagtgggaagtacctgcgcaaattttcgcacgtcctttagaagtg
agtaaaggcgaggagataacgccacaagaagtcattgatgaactcaatttgctgggctat
cgcaaggtggcttttgctgacagtagcggtgaatatagctatcaaaacaaggtgttaact
gtgcagcgccgcgcgtttcaattccccgagggagcggagcctcttcgacacttagtatta
acgtgggaaggggcgcgtatcggtgaaatatacgataagtcacaaggccgtccctacggt
tctgtaaagttagagccatggctagtaacacgcatgacgagcggctctcatgaagaccgc
atgttagtgacgttagatactatccctgaaatgttacctaaagcgctgacgctggtggaa
gatcgcaatttttataaccaccatggtgttgcaccactttcaatattgcgggccctaatg
gcgaatattgctgctggtcgtacggttcaaggtggtagcacgctgacgcagcagctggtt
aaaaacatgtttttaacccgcgaacgttctcttgtacgcaaggctaaagaggccataatg
gcggtcattatagacgcccgctacagcaagtctgagattatcgaagcctatttaaatgag
gtgtttttagggcaaaacggcgacatggctgtacatggatttgggcttgctagctatttc
tactttgaccgtccggccaacgagctaagcacgcccgaaatagccacgctggttgctatt
atcaaaggcccatcttattacaatccacgaaagtatgcagagcgcacaaaagagcgtcga
gatttagtacttcgaatgttgttcgatgaaaatgaaataaaccgtcaagactacgagcgc
tatgtgaacatgccgttagggcttgccagcggtgcgagtttagcaagcggtaaacaccct
gctttcatggagcaggttcgcaaagaactcaatgaaattttagcagagccgagcctaaga
gactcgggcgttaaagtgtttaccacactggatatcgttgctcagcgtcgggcagaaaaa
gcactgtctagcaccctaaacgggctgcaaaaagatcgcagcgtgccgcttcaaggcgct
atggttgtcactgacagcgcaagcggtgaagtacgcgctatcgtaggtggtaaagacttt
gcatttaaaggttttaatcgagcattagatgctaagaggccaataggctcattgattaaa
ccagctgtgtacttaactgccttagaagatcctacccagtttaacttggctacacccctt
aaagacgagccaattaccctagaaagtagaaacggcaccgaatggtcgccgcaaaactac
gataaagagttcagagggcaggtgcctctgcttcaggggttagtcgaatctttgaacgtg
ccaacagttaatttaggcatgcagataggcctagatgcgttagccgataccattgagcgg
ttaggggttaccacgccagtagataaagtaccgtcgttaaccttgggcgctttcgaacta
acgccatttagcacaaaccaaatgtatcaaaccctatcaaacgatggccgctacataccg
cttcacacggtgagctctgtggttacggcagataatgcattactttggaagaaggccgag
ttctttgctcagcgcacggatgaagccgccacttacttactgaactacgccctgtacaag
gtgaccacagaaggtacagcaaaacgcataggctggaactttggtaatgtaaatatggca
gggaaaacaggtacaaccgatgattatcgagatagttggtttagcggtttcgacagaaat
aatgtggtgaccgtttgggtcggcaatgacgataatcaaccagtgaatttaaccggtgca
ggtggcgcgctgcctgtgtttgtaaattatatgaagtcacagtcaccgaagtctctatct
agacgtttccctaaagggttaggtattgcacatttcgatgcgaagacgggggcggtagtg
gtcgctgggtgcgcaggaagtttaagtgttccggctattttggatgtactgcctcctgcg
cagcaagattgtgctggtcgcccggtagacgaaaacggcgataagaaagaaaaaagctgg
tgggagcgtatatttggataa

DBGET integrated database retrieval system