KEGG   Alteromonas mediterranea MED64: I533_04610Help
Entry
I533_04610        CDS       T02958                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00061  Fatty acid biosynthesis
amag00780  Biotin metabolism
amag01100  Metabolic pathways
amag01212  Fatty acid metabolism
Module
amag_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    I533_04610 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    I533_04610 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amag01004]
    I533_04610 (fabZ)
Enzymes [BR:amag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     I533_04610 (fabZ)
Lipid biosynthesis proteins [BR:amag01004]
 Fatty acid synthase
  Component type
   I533_04610 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AGP80911
LinkDB All DBs
Position
1019713..1020162
Genome map
AA seq 149 aa AA seqDB search
MANSLNTIEIQEILELLPHRYPFLLVDRVTDYVLGESVKAYKNITINEPCFMGHFPEQPI
FPGVLILEAMAQAAGVLGFKTMGNNDKLYLYAGIDNARFKRPVVPGDRLEFDVALVKERR
GIWKFKGTASVDGDIACVAEFMCAMREIA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggccaattcacttaataccatcgaaattcaggaaatattggaactgttacctcatcgg
tatccattcctacttgttgatcgtgtaacagactatgttctgggtgagtctgtaaaggct
tataagaatatcactatcaatgagccgtgtttcatggggcactttcctgaacagccaatt
ttcccaggtgtattaattcttgaagcaatggcacaagctgctggtgttttaggatttaag
acaatgggtaacaatgataagttatacttgtatgcagggattgataacgcacgctttaag
cgtccggttgttccaggtgacaggcttgagtttgatgttgctctagttaaagagcgcaga
gggatttggaaatttaaaggcactgcaagcgttgatggcgatatcgcttgtgttgcagag
tttatgtgtgcgatgagagagatagcttaa

DBGET integrated database retrieval system