KEGG   Alteromonas mediterranea MED64: I533_09455Help
Entry
I533_09455        CDS       T02958                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00020  Citrate cycle (TCA cycle)
amag00190  Oxidative phosphorylation
amag00650  Butanoate metabolism
amag01100  Metabolic pathways
amag01110  Biosynthesis of secondary metabolites
amag01120  Microbial metabolism in diverse environments
amag01130  Biosynthesis of antibiotics
amag01200  Carbon metabolism
Module
amag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I533_09455 (sdhA)
   00650 Butanoate metabolism
    I533_09455 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I533_09455 (sdhA)
Enzymes [BR:amag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I533_09455 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     I533_09455 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGP81861
LinkDB All DBs
Position
2109218..2110990
Genome map
AA seq 590 aa AA seqDB search
MSLPVHEFDAVVIGAGGAGMRAALQISESGKSCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAIIEMENMGLPFSRFENGKIYQRPFG
GQSKNFGGEQGARTAAAADRTGHALLHLLYQQNVKNKTKVFSEWYALDLVKNQDGDVVGC
TAIDIESGEVVYFKSRAVVLATGGAGRIYASTTNAHINTGDGVGMALRAGVAVQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMTEIREG
RGCEGPWGTHIKLKLDHLGKDVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTNVDGQCLTVDENGNDKVVNGLFACGEIACVSVHGANRLGGNSLLDLVVFGRATGLHLG
KTLSDMAPTRDASESDLEASMARFNRWENSEKGKGEDPVQIKKDLQECMQLNFSVFREGD
AMAEGLKELSEIRERLKNARLDDKSSDFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDDNWLCHSIYDPNTDKMIKREVNMAPKLREAFPPKVRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacccgttcacgagtttgatgcagtagtaattggtgccggcggtgccggtatg
cgcgcagcactccagatttcagagtctggtaaatcttgcgctctgctttcaaaagtattt
ccaacccgttctcacactgtgtctgcacaaggtggtattaccgtagcattgggtaattca
cacgaagacaactgggaatggcacatgtatgacaccgtaaaggggtcagattatatcggt
gaccaagacgctatcgaatacatgtgtaagacaggacctgaagcaatcattgagatggag
aacatgggtcttcctttctctcgcttcgaaaacggtaaaatttaccagcgtccttttggt
ggtcagtctaagaactttggtggcgagcagggtgctcgtacggcagcagcggctgaccgt
accggtcacgcacttcttcaccttctttaccaacaaaacgtaaagaataaaacaaaagta
ttttctgagtggtacgcgctagatttagtgaaaaaccaagacggtgacgtagtaggttgt
acagcaatcgacatcgaatctggcgaagtagtttacttcaagtcgcgcgctgttgtactt
gcaacgggtggtgcagggcgtatctatgcgtctaccacaaacgcacacatcaataccggt
gacggtgtgggtatggcgcttcgtgcaggtgttgcagttcaggatatggaaatgtggcag
ttccacccaacgggtattgctggcgcaggtacattggttaccgaaggttgtcgcggtgaa
ggtggttaccttttaaacaaagacggcgagcgcttcatggaacgttatgcgccaaacgcg
aaagaccttgctggtcgtgacgttgttgctcgttcaatgatgacggagattcgcgaaggt
cgcggttgtgaaggcccatggggtacacacattaagcttaagcttgatcaccttggtaaa
gacgttcttgaatcgcgtctacctggtatccttgagctatcccgtacgtttgcacacgtt
gacccagtaaaagagccaattccagtaattcctacttgtcactatatgatgggtggtatt
ccaactaacgttgatggccaatgtctaacggttgatgaaaacggtaacgacaaggttgtt
aatggtctatttgcttgtggtgagattgcttgtgtatcggtacacggcgctaaccgcctt
ggcggtaactcgctacttgaccttgttgtattcggtcgtgcgactggcttacaccttggt
aagacattatctgatatggccccaacgcgcgacgcgtcagaatctgatcttgaagcgtca
atggctcgtttcaatcgttgggaaaattcagaaaaaggcaagggcgaagacccagtccaa
attaagaaagatttgcaagaatgtatgcagcttaacttctcggtattccgtgaaggtgac
gcaatggcggaaggacttaaagagcttagcgaaattcgtgagcgcctcaagaatgctcgc
cttgacgacaagagttcagacttcaatacccaacgtatagagtgtttagaacttgataac
cttatggaaaccgcgtacagcacggcagtagcagcgaatttcagaacggaaagccgtggc
gcacacagccgcttcgacttcccggaccgagatgatgataactggctatgtcacagcatt
tatgatccgaacacggataaaatgattaaacgtgaagtgaatatggcgcctaagcttagg
gaagcattcccgcctaaagtgcgttcatattaa

DBGET integrated database retrieval system