KEGG   Alteromonas mediterranea MED64: I533_09460Help
Entry
I533_09460        CDS       T02958                                 

Definition
(GenBank) succinate dehydrogenase catalytic subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
amag  Alteromonas mediterranea MED64
Pathway
amag00020  Citrate cycle (TCA cycle)
amag00190  Oxidative phosphorylation
amag00650  Butanoate metabolism
amag01100  Metabolic pathways
amag01110  Biosynthesis of secondary metabolites
amag01120  Microbial metabolism in diverse environments
amag01130  Biosynthesis of antibiotics
amag01200  Carbon metabolism
Module
amag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amag_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I533_09460
   00650 Butanoate metabolism
    I533_09460
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I533_09460
Enzymes [BR:amag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I533_09460
    1.3.5.4  fumarate reductase (quinol)
     I533_09460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGP81862
LinkDB All DBs
Position
2111005..2111715
Genome map
AA seq 236 aa AA seqDB search
MQLTFSIYRYNPEVDAKPRMQDYTLEVEEGQDMMVLDALLALKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGKGKIVVRPLPGLPVVRDLVVDMTQFYTQYEKIKPFLI
NDSKQPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATEERLNELDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGQIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaactttttcgatttatcgttataacccagaagtggatgcgaagcctcgcatg
caagactacactctagaagtagaggaaggtcaagacatgatggtgctagatgcgctactt
gcacttaaagagcaggatccgacgctttctttccgtcgctcatgccgcgaaggtgtatgt
ggttctgacggtgtaaacatgaacggcaaaaacggcctagcatgtattactccactttct
gcgctgggcaaaggcaaaatagtcgttcgtccacttccaggtctacctgttgtacgtgac
cttgttgttgatatgacgcagttctatacacagtacgaaaagattaagcctttcttaatt
aacgacagcaagcagccgccggctcgtgagcaccttcagtcacctgaagagcgcgctaag
ttagatggtttatatgagtgtatcttatgtgcatgctgttcgacgtcttgcccatcattt
tggtggaaccctgacaagtttatcggtccggccggtctacttcacgcttatcgattctta
attgatagccgtgacactgcgacagaagagcgtcttaacgagcttgacgatgcattcagc
gtattccgctgtcacggtatcatgaactgtgtaagtgtatgtcctaaaggattgaaccca
acaaaagctattggccaaatcaagtcaatgcttttacaacgggctgtttag

DBGET integrated database retrieval system