KEGG   Aquitalea magnusonii: DLM_0350Help
Entry
DLM_0350          CDS       T05698                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amah  Aquitalea magnusonii
Pathway
amah00020  Citrate cycle (TCA cycle)
amah00190  Oxidative phosphorylation
amah00650  Butanoate metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
amah01120  Microbial metabolism in diverse environments
amah01130  Biosynthesis of antibiotics
amah01200  Carbon metabolism
Module
amah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLM_0350
   00650 Butanoate metabolism
    DLM_0350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DLM_0350
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DLM_0350
    1.3.5.4  fumarate reductase (quinol)
     DLM_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA HI0933_like Pyr_redox_3 SAM_decarbox NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BBF84022
UniProt: A0A3G9GD48
LinkDB All DBs
Position
349190..350962
Genome map
AA seq 590 aa AA seqDB search
MGVPVRHFDAVIVGAGGAGMRAALQLSEAGLKTAVLSKVFPTRSHTVAAQGGVSASLGNS
EEDHWTWHMYDTVKGSDWLGDQDAIEFMCREAPKVVTELEHYGMPFDRNADGTIYQRPFG
GHMSNFGEKPVRRACAAADRTGHAMLHALYQRNVRANTHFFVEWMALDLIRDADGNVQGV
VAMEMETSEIVVFQAKATLFATGGAGRIYASSTNAFINTGDGLGMAARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILRNSAGERFMERYAPNAKDLASRDVVSRAMVTEINEG
RGCGPNKDHVLLDITHLDPEVIMSKLPGIREISIKFAGVDPIKAPIPVVPTCHYQMGGIP
TNYHGEVVVEGKPVHGFYAAGECACASVHGANRLGTNSLLDLLVFGKSSANSMIDFIKQQ
PLELPTLATADVDRAVARVERLNKQTNGVAVNDARTAMQRTMQAHCGVFRFKDMLAEGVE
KILEVEKMVQQTEISDKSSVFNMARIEALELENLIEVAKATMISANARTESRGAHVRDDA
PDTPETPNGRDDANWLKHTLWSREGNRLEYKPVNLQPLTVDTIALKTRSY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtacctgttcgtcattttgatgcagtaatcgttggcgcaggtggtgccggcatg
cgtgccgccctgcaactgtccgaagctggtctgaagactgccgtcctgtccaaggtattc
cccactcgctcccacaccgtggctgcgcaaggtggtgtttccgcctcgctgggtaattcc
gaggaagatcactggacctggcacatgtacgacaccgtaaagggttcggactggctgggt
gatcaggatgccatcgaattcatgtgccgcgaggcaccgaaggtggtgaccgaactggaa
cactacggcatgccgtttgaccgtaacgctgacggcaccatctaccagcgtccgttcggc
ggtcacatgtccaacttcggtgaaaagccggtgcgtcgcgcctgtgctgccgccgaccgt
accggtcatgccatgctgcacgcgctgtatcagcgcaatgtgcgtgccaatacccacttc
tttgtcgagtggatggcgctggacctgattcgcgacgccgacggcaatgtgcaaggcgtt
gttgccatggaaatggaaacctcggaaatcgtggtattccaggccaaggccaccctgttt
gcgactggcggtgccggtcgtatctatgcttcttccaccaatgccttcatcaataccggt
gatggcctgggcatggccgctcgtgccggcatcccgctggaagacatggaattctggcaa
ttccaccccactggcgttgctggtgccggtgtactgattaccgaaggtgtccgtggcgaa
ggcggcatcctgcgcaacagcgcgggtgaacgcttcatggaacgctatgcgccgaacgcc
aaggatctggcttcgcgcgacgtggtgtcccgtgccatggtgaccgagatcaacgaaggc
cgtggttgcggcccgaacaaggatcacgtgctgctggacatcactcacctcgaccccgaa
gtgatcatgtccaagctgccgggcatccgtgaaatttccatcaagtttgccggtgtggac
ccgatcaaggccccgattccggtagtgccgacctgtcactaccagatgggtggcatcccc
accaactaccacggcgaagtggtggtggaaggcaagccggtacatggcttctacgccgct
ggcgaatgcgcttgcgcctcggtacacggtgccaatcgcctgggtaccaactccctgctc
gacctgctggtgttcggcaagagctcggccaactcgatgatcgacttcatcaagcaacag
ccgctggaactgccgacactggccactgccgatgtggatcgtgccgttgcccgtgtggaa
cgcctgaacaagcaaaccaacggtgtggccgtcaacgatgcccgtaccgccatgcagcgc
accatgcaggcgcattgcggcgtgttccgcttcaaggacatgctggccgaaggtgttgag
aagattttggaagtggaaaagatggttcaacagaccgaaatttccgacaagtccagcgtg
ttcaacatggcccgcatcgaggcactggagctggaaaacctgatcgaagtggccaaggcc
accatgatctcggccaatgcccgtaccgaatcacgcggcgcgcacgtgcgtgacgatgca
ccggatacgccggaaaccccgaacggtcgtgacgatgccaactggctgaagcacaccctg
tggagccgcgaaggcaaccgtctggaatacaagccggtgaacctgcagccgctgactgtc
gacaccattgctctgaagacacgttcctactaa

DBGET integrated database retrieval system