KEGG   Aquitalea magnusonii: DLM_0351Help
Entry
DLM_0351          CDS       T05698                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
amah  Aquitalea magnusonii
Pathway
amah00020  Citrate cycle (TCA cycle)
amah00190  Oxidative phosphorylation
amah00650  Butanoate metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
amah01120  Microbial metabolism in diverse environments
amah01130  Biosynthesis of antibiotics
amah01200  Carbon metabolism
Module
amah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLM_0351
   00650 Butanoate metabolism
    DLM_0351
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DLM_0351
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DLM_0351
    1.3.5.4  fumarate reductase (quinol)
     DLM_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-ProteinID: BBF84023
UniProt: A0A0F3KNG6
LinkDB All DBs
Position
350976..351686
Genome map
AA seq 236 aa AA seqDB search
MTTETVKFRIYRYDPDKDAKPYMQDISVELDSTDRKLLDALTKLKVKDDTITFRRSCREG
VCGSDAMNINGKNGLACLTDFRDLKQPIELRPLPGLPVVRDLIVDMTQFFKQYHSIKPYV
INDTPPPERERLQSPEDREELNGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFI
ADTRDTAINERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKDLMVKRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaaccgtcaaattccgcatctaccgttacgatccggacaaggatgccaag
ccctacatgcaggacatcagcgtggagctggattccaccgaccgcaagttgctggatgcg
ctgaccaagctgaaggtgaaggacgacaccatcaccttccgtcgttcctgccgcgagggt
gtgtgtggctctgacgccatgaacatcaacggcaagaatggtctggcctgtctgaccgat
ttccgcgatctgaaacagccgatcgagctgcgtccgctgccgggtctgccggtggtgcgc
gacctgatcgtcgacatgacccagttcttcaagcaataccactcgatcaagccgtacgtg
atcaacgacacgccgccgccggaacgcgagcgcctgcaaagcccggaagaccgtgaagaa
ctcaacggcctgtacgagtgcattctgtgcgcctgctgctccaccagttgcccgtcgttc
tggtggaatccggacaaattcgttggcccggccggcctgctcgcagcctatcgcttcatt
gccgatacccgcgacaccgccatcaacgaacgtctggacaatctggaagatccgtaccgt
ctgttccgttgccacaccatcatgaactgtgtcgatgtctgccccaagggcctgaacccc
accaaggcaatcggcaagatcaaagacctgatggtcaagcgtgcagtatga

DBGET integrated database retrieval system