KEGG   Aquitalea magnusonii: DLM_0631Help
Entry
DLM_0631          CDS       T05698                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
amah  Aquitalea magnusonii
Pathway
amah00061  Fatty acid biosynthesis
amah00780  Biotin metabolism
amah01100  Metabolic pathways
amah01130  Biosynthesis of antibiotics
amah01212  Fatty acid metabolism
Module
amah_M00083  Fatty acid biosynthesis, elongation
amah_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DLM_0631
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DLM_0631
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DLM_0631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amah01004]
    DLM_0631
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DLM_0631
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DLM_0631
Lipid biosynthesis proteins [BR:amah01004]
 Fatty acid synthase
  Component type
   DLM_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: BBF84284
UniProt: A0A0F3KAR8
LinkDB All DBs
Position
complement(648708..649496)
Genome map
AA seq 262 aa AA seqDB search
MGFLQGKKILITGMISNRSIAYGIAQACHREGAELAFTYVVDKLEDRVREMAKDFGSELV
FRCDVQSDDEINQLFVDLGKQWDGLDGLVHAIAFAPRESLEGDFLDALSREAFQTAHDVS
SYSFPALAKAARPMMQGRNGALLTLSYLGAVRAIPNYNVMGLAKASLEASVRFMAASLGK
DGIRVNGLSAGPIKTLAAAGISGFSKLLSIAAGQSCLRRNVTTEEVGNTAAFLLSDLSSG
ITGEITYVDAGFSINSMNVPDA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctgcaaggcaaaaaaattctgattaccggcatgatctccaaccgctccatc
gcttatggcatcgcacaagcctgccatcgcgaaggtgccgagctggcgttcacctatgtg
gtggacaagctggaagatcgtgtacgtgaaatggccaaggattttggcagcgaactggtg
ttccgctgcgatgtacaaagcgacgatgaaatcaaccagctgtttgtcgacctgggcaaa
cagtgggacggcctggacggcctggtacacgccattgccttcgccccgcgcgaatcgctg
gaaggcgacttcctggatgcactgagccgcgaagcattccagactgcacacgatgtgtcg
tcctacagcttcccggcactggccaaggctgcccgcccgatgatgcaaggccgtaacggc
gccctgctgaccctgtcctacctgggcgcggtacgtgccatccccaactacaatgtgatg
ggtctggccaaggccagcctggaagcatcggtacgcttcatggctgccagcctgggcaag
gacggcatccgtgtgaacggcctgtccgccggtccgatcaagaccctggctgccgctggc
atttccggcttctccaagctgctgtccattgctgccggccaatcctgtctgcgccgcaat
gtgaccaccgaagaagtgggcaacaccgctgccttcctgctgtcggatctgtcctccggc
atcaccggcgaaatcacctatgtggacgccggcttcagcatcaactcgatgaacgtgccg
gacgcctga

DBGET integrated database retrieval system