KEGG   Aquitalea magnusonii: DLM_1707Help
Entry
DLM_1707          CDS       T05698                                 

Definition
(GenBank) L-aspartate oxidase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amah  Aquitalea magnusonii
Pathway
amah00020  Citrate cycle (TCA cycle)
amah00190  Oxidative phosphorylation
amah00650  Butanoate metabolism
amah01100  Metabolic pathways
amah01110  Biosynthesis of secondary metabolites
amah01120  Microbial metabolism in diverse environments
amah01130  Biosynthesis of antibiotics
amah01200  Carbon metabolism
Module
amah_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amah_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amah_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLM_1707
   00650 Butanoate metabolism
    DLM_1707
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DLM_1707
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DLM_1707
    1.3.5.4  fumarate reductase (quinol)
     DLM_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 DAO GIDA FAD_oxidored AlaDh_PNT_C HI0933_like FAD_binding_3 BcsB Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BBF85324
UniProt: A0A3G9GD88
LinkDB All DBs
Position
complement(1794705..1796327)
Genome map
AA seq 540 aa AA seqDB search
MTSAIPYLQALSNLHAHAQPALRPADLSRSALLAQYHPDNADNASTLLQIGPSRGQPCHP
RLAALLQSNALIDGFDLAGAEQRSTEVLVIGGGGAGAAAALTAARSGAEVILASKLRLGD
SNTVMAEGGIQAALAANDSPQQHFDDAMRGGHQAANAQLLAQMASDAPGVIRWLIELGMH
FDLEDPFTDGGKLRYKQAGGCSQPRILCYRDYTGLEMMRVLRETVELEPAITQLNRCPVV
ELLSHEDGSCAGAVLYDLEYQRFIVVSARQTILATGGCGRLHLQDFPTSNHYGATADGLV
LAYRIGAGLRDMDAFQYHPTGVAWPQRLRGGLISEAARSGGALLVNGLGERFVEELAPRD
VVTAAILRECAAGRGIERNGQIGVFLDTRQLGADLASRLPALQHLADKCGIDPSREPMLI
YPTLHYQNGGVIIDGNGQTAVPGLLCAGEITGGIHGRNRLMGNALLDILAFGRRAGRQAA
RLAQAARHKSTLPPQRGGIEHVYRWQRQLALAGLDSSQQAPLLYPGDARLKLQRPTGPRV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgactagcgccattccctatctgcaggccctgagcaatctgcacgcccatgcacagcca
gcgctgcgtccggccgacctgtcgcgcagcgcgctgctggcgcaataccacccggacaat
gccgacaatgccagcaccctgctgcagatcggccccagccgtggccagccctgccacccg
cggctggcggcgctgctgcaaagcaatgcgctgatcgacggctttgacctggccggtgcc
gaacagcgcagcaccgaggtgttggtgattggcggtggtggtgccggtgccgccgccgcg
ctgaccgccgcgcgcagcggtgccgaggtgatcctggccagcaagctgcgcttgggcgac
agcaataccgtgatggccgaaggcggcattcaggccgcactggccgccaatgacagcccg
caacaacactttgacgatgccatgcgcggcggacaccaggcggccaatgcgcaattgctg
gcgcagatggccagtgatgcacccggtgtgattcgctggctgattgagctgggcatgcac
tttgatctggaagacccgttcaccgatggcggcaagctgcgctacaagcaggcgggcggc
tgcagccagccgcgcatcctgtgctatcgcgattacaccgggctggagatgatgcgggtg
ctgcgcgaaacggtagagctggaacctgccatcacccagctcaaccgctgtccggtagtg
gaactgctgtcgcatgaagacggcagttgtgccggtgccgtgctgtacgatctggaatac
cagcgtttcatcgtggtttccgcccgccagaccattctggccaccggaggctgcggccgg
ctgcatctgcaggacttccccacctccaatcactacggtgccaccgccgacgggctggtg
ctggcctaccgcatcggtgccggcttgcgtgacatggatgccttccagtaccaccccacc
ggcgtggcctggccacagcgcctgcgtggcgggctgatctccgaagccgcccgctccggc
ggggccttgctggtcaacgggctgggcgagcgctttgtcgaagaactggccccgcgcgat
gtcgtcaccgccgccatcctgcgcgaatgcgccgccggacgcggcatcgaacgcaatggt
cagatcggcgtgttcctggacacccggcaactgggggccgacctggccagccgcctgccc
gcactccagcatctggccgacaaatgcggcatcgaccccagccgcgagcccatgctgatc
taccccaccctgcactaccagaacggtggcgtcatcatcgacggcaacggccagaccgcc
gtacccggcctgctgtgcgccggggaaatcaccggcggcatccatggccgcaaccggctg
atgggcaatgcgctgctggacatcctggcctttggccgccgtgccggtcgccaggccgcc
cgcctggcccaggccgcccgtcacaaatccaccctgccaccacaacgtggcggcatcgaa
cacgtctaccgctggcaacgccagttggccctggccggactggacagcagccagcaagca
ccattgctctaccccggcgatgcacggctgaaactgcagcgccccaccggcccgcgcgtc
tag

DBGET integrated database retrieval system