KEGG   Aquitalea magnusonii: DLM_3788Help
Entry
DLM_3788          CDS       T05698                                 

Definition
(GenBank) alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amah  Aquitalea magnusonii
Brite
KEGG Orthology (KO) [BR:amah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DLM_3788
Enzymes [BR:amah01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DLM_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_oxidored FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin NAD_binding_8 NAD_binding_7 Thi4 K_oxygenase FMO-like NAD_binding_9 AlaDh_PNT_C baeRF_family10
Motif
Other DBs
NCBI-ProteinID: BBF87372
UniProt: A0A3G9GNX9
LinkDB All DBs
Position
complement(4066675..4068249)
Genome map
AA seq 524 aa AA seqDB search
MQLPEDIPMLDTTIKTQLTAYLEKLQQPIELIASLDDSAKAQEMFSLLQDIASLSPKVTL
NSNGQAARRPSFAIARPGEAGRIEFAGIPMGHEFTSLVLALLQTGGHPPKVDEDTIAQIR
GLQGSYQFEVFVSLSCHNCPDVVQAVNLMAVLNPNVRSVMIDGGVFQQEVTERQIMGVPA
IYLNGEQFGSGRMGLEEIIAKLDSGAVAREAEKIAAKEAFDVLIVGGGPAGAAAAIYAAR
KGIRTGVVAERFGGQVLDTLAIENFISVQETEGPKLAMALEQHVKSYDVDVMNLQRAAAL
KPAQNGQLAEVTLESGAVLKSKAVIVATGARWREMNVPGEAEYRAKGVAYCPHCDGPLFK
GKRVAVIGGGNSGVEAAIDLAGIVTHVTLLEFGDSLRADAVLQKKLHSLPNVRVITNAQT
TEVTGDGQKVNGLSYQERITGETHHVALEGIFVQIGLLPNTDWLKGSVALSPRGEIEVDA
KGQTSAEGVFAAGDATTAPYKQIIIAMGEGAKASLSAFDYLIRS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgcaattgcctgaggatattcccatgctcgacaccaccatcaagacccaactgaccgcc
tacctggaaaaactgcagcagccgatcgaactgattgccagcctggatgacagcgccaag
gcgcaggaaatgttcagcctgctgcaagacattgccagcctgtcgcccaaggtaacgctg
aacagcaatggccaggccgcgcgtcgcccgtcctttgccatcgcccgccccggtgaagct
ggccgtatcgagtttgccggtatcccgatgggccacgaattcacctcgctggtgctggct
ctgctgcaaaccggtggccatccgcccaaggtggacgaggacaccattgcccagattcgc
ggcctgcaaggcagctaccagtttgaagtgtttgtctcgctaagctgccacaactgcccg
gacgtggtacaagccgtcaacctgatggcagtgctcaaccccaatgtgcgtagcgtgatg
attgatggcggtgtgttccagcaggaagttaccgagcgtcagatcatgggcgtaccggcc
atctatctgaatggtgaacagtttggcagtggccgcatgggcctggaagaaatcatcgcc
aagctggatagcggtgccgtggcgcgtgaagccgaaaagattgccgccaaggaagcattc
gacgtgctgatcgtcggcggtggcccggccggcgcggctgccgccatctatgcggcgcgc
aagggcatccgtaccggtgtggtggccgagcgtttcggcggccaggtgctggatacgctg
gcgattgaaaacttcatctcggtgcaggaaaccgaagggcccaagctggcgatggcgctg
gaacaacacgtcaaatcctacgatgtggacgtgatgaacctgcaacgcgctgctgcgctc
aagccggcgcaaaacggccaactggccgaggtgacgctggaaagcggtgccgtgctcaag
agtaaggcggtgattgtggccaccggtgcgcgctggcgcgaaatgaatgtgccgggcgaa
gccgaataccgcgccaagggcgtggcttactgcccgcactgcgatggcccgctgttcaag
ggcaagcgtgtggcggtgattggcggtggtaactctggcgtggaagccgccatcgacctg
gccggcatcgtcacccatgtcaccctgctggagttcggtgacagcctgcgcgccgatgcg
gtgttgcagaagaaactgcacagcctgcccaatgtgcgcgtcatcaccaatgcccagacc
accgaagtgaccggcgacggtcagaaggtgaacggcctgagctatcaggagcgcattacc
ggggagacccaccatgtggcgctagaaggcatttttgtgcagatcggcctgctgcccaat
accgactggctgaaaggcagcgttgccttgtcgccgcgcggtgagatcgaagtggatgcc
aagggccagacttcggccgagggggtgtttgctgccggtgatgccaccacagcaccgtac
aagcagatcatcatcgccatgggcgaaggtgccaaggccagcctgtcggcctttgactac
ctgatccgcagctaa

DBGET integrated database retrieval system