KEGG   Alteromonas mediterranea UM7: I635_01335Help
Entry
I635_01335        CDS       T02724                                 

Definition
(GenBank) two-component response regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:amai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I635_01335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:amai02022]
    I635_01335
Two-component system [BR:amai02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   I635_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF3653 RisS_PPD
Motif
Other DBs
NCBI-ProteinID: AGP95814
UniProt: S5BXH8
LinkDB All DBs
Position
complement(302378..303085)
Genome map
AA seq 235 aa AA seqDB search
MQTPNVLIVEDEVVTRTTLKSLFEAEGYNVFEAENGDQMHDFFENHAINLVIMDINLPGK
NGLILAREVRDRKNVGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNLLSR
TTNSSEDDDLPSRVNFNGWTLDGDSRSLISPNGKEFRLPRSEFRALHLFLSNPGKILTRE
QLIMEMTGRELRPNDRTVDVTIRRIRKHFESDPTDEELIVTIHGEGYRFCGQVDG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgccaaatgtgttaattgttgaagatgaagtggtaacccgtaccacgcttaag
agtttgtttgaagcggaagggtataatgtatttgaagccgaaaacggcgatcaaatgcat
gatttcttcgagaatcacgctatcaatttggttatcatggatattaacctacctggaaag
aacggcttgattctagcgcgtgaagttcgcgaccgtaaaaatgttggccttatcttccta
acgggcagagataacgatgttgaccgtatcttaggtcttgaaatcggcgcagacgattac
ctgacaaagccgttcaacccacgtgaattaactattcgcgcgcgcaacttactgtctcgc
acaaccaactcttcagaagacgacgatttaccaagccgtgtaaactttaacggttggacg
cttgatggtgatagccgttctttgatttcacctaacggtaaagagttccgcttaccgcgt
agtgaattccgcgcactacacctgttccttagcaatccaggtaaaatccttactcgtgaa
cagctcatcatggaaatgacaggtcgtgagcttcgtcctaacgaccgtacggtagacgta
accattcgccgtattcgtaagcacttcgagtcagacccgacagatgaagagttgatcgta
accattcacggtgaaggctaccgcttctgcggtcaggttgatggttaa

DBGET integrated database retrieval system