KEGG   Alteromonas mediterranea UM7: I635_16180Help
Entry
I635_16180        CDS       T02724                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amai  Alteromonas mediterranea UM7
Pathway
amai00052  Galactose metabolism
amai00511  Other glycan degradation
amai00600  Sphingolipid metabolism
amai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I635_16180
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    I635_16180
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    I635_16180
Enzymes [BR:amai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I635_16180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1
Motif
Other DBs
NCBI-ProteinID: AGP98743
UniProt: S5CCR2
LinkDB All DBs
Position
3627109..3629826
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTLLLLATNVTAKQREKIDFTGEWRFYRYADNQTPDSLIYDTRPNVNQ
FDDSQAADTRPSDAVTVNSHDGVLKSWILPTGNAFIANPDKRHVRPEGEPGKDFPFVQRA
FDDSHWKVANLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLAKDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWLEKTAQIHISQWGTQVITPTVSKDKATISITTSIRNHTKNDQNVSLQHHIY
ELSKQDTLSENPVLTLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEEGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFENTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WSGREGEITPVHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEVVTYKN
GKRWATDSVTTSGVPSGLRLSADRNIINADGKDLSFVTVDIVDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFCGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattaggaattataagggactacttgcccttaccttgctactgttagccaca
aatgttacagccaagcaacgagaaaaaattgattttactggagaatggcgattttaccgc
tacgccgataatcaaacgcctgatagcttgatttacgatactcgccccaacgttaaccag
tttgacgacagccaagcggcggatactcgcccttccgatgcggtaacagttaatagccac
gatggcgtattaaaatcctggattcttcccacgggaaatgcgtttattgctaaccccgat
aagcgccatgtaagacccgaaggcgaaccaggcaaagattttccatttgttcagagagcg
ttcgatgacagccattggaaagtggcgaatttacctcacgactgggccatcgcagggcca
ttctatagtggcaacaatcctaaagtggggggcggtatgggacgtctaccctcccacgga
gtagcgtggtatagaaagcagtttacgcttgctaaagacgataaaaacaaacgtatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggctaaatggtcatcttgtcggg
ggttggccttatggttatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggtggcggtatctatcgaaatgtatggttagaaaaaaccgcacagatccatatcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccacgatatcgattacc
acatcaatcagaaatcatacgaaaaatgatcagaacgtgagtcttcaacaccatatttat
gagctttcaaagcaagatacccttagcgaaaatccggtattaacgcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagctacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaacggaaaaacacttgaccaatacaccacgcccttcggcgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggctgcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacgttaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagaaggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccctacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgaatttgaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgcgccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcg
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctggccagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccggcatgatcgatctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcatattcttccccattggaat
tggtccggtagagagggagaaatcactcctgttcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcacaagggaagaaaaagaaaggtccctttgaatatcga
cttcgctttgatgatgttcgctacacgccgggaacagtagaagtggttacctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgtcccctcaggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcgtagataaaaaggggaatccagtaccgactgcgactcaccgcgttcacttttcgctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgagaggaaggcgttttgtggaaagctacttgttatcattcaaagtgagcac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system