KEGG   Alteromonas mediterranea U4: I607_00305Help
Entry
I607_00305        CDS       T02720                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00260  Glycine, serine and threonine metabolism
amal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    I607_00305 (tdh)
Enzymes [BR:amal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     I607_00305 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 HI0933_like Pyr_redox_3 FAD_oxidored Pyr_redox_2 2-Hacid_dh_C AdoHcyase_NAD FAD_binding_2 MTS Methyltransf_11 Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AGP83873
LinkDB All DBs
Position
70936..71961
Genome map
AA seq 341 aa AA seqDB search
MKSLVKAKAEKGIWLQDTPKPEVGHNDLLIKIRKTAICGTDMHIYNWDEWSQNTIPVPMV
VGHEYVGEVVGMGQEVKGFEVGDRVSGEGHITCGHCRNCRAGRVHLCRNTEGVGVNRPGA
FAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVAKHVGARHVVVTDINPYRLELAKKMGATRTVDVSKENLQDVMDELGMSEGFDVGLEMS
GVPVAFRDMLNKMNHGGKIAMLGIPPQDVAVDWNQVIFKGLVIKGIYGREMFETWYKMAS
LLQSGLDLSPIITHTFSIDDFQKGFDTMGSGHSGKVILDWQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctagtaaaagcgaaggcggaaaaaggcatttggctgcaagacacgccaaag
ccggaagtcgggcacaacgacctgctgattaaaattcgcaaaaccgctatttgcggtacc
gatatgcatatctacaactgggatgaatggtcacaaaacaccattcccgtgcctatggtg
gtaggccacgaatacgtgggtgaagtagtgggtatgggccaagaagtgaaaggctttgag
gtaggcgatcgcgtgtctggcgaaggccacattacctgtggtcactgccgtaattgtcga
gccggccgtgttcacttgtgtcgtaacacggaaggtgtgggtgtaaaccgcccgggggcc
tttgccgaatatttagttattcctgccttcaacgcgtttaaaattccagacaatatcagc
gacgacctagcgtccatatttgacccatttggtaatgctgttcataccgcgctaagtttc
gacttagtaggcgaagacgtacttatcacaggtgcaggacctatcggcattatggcggct
gcggtcgccaagcacgtaggtgcgcgtcatgttgtggttaccgatatcaacccttatcgc
cttgagcttgctaaaaaaatgggtgctacacgcactgttgatgtcagtaaagaaaaccta
caagacgttatggatgagctgggcatgtcagaaggcttcgacgtaggcctagaaatgtcg
ggcgtgccggtagccttcagagacatgctgaacaaaatgaaccacggcggcaaaatagcc
atgctaggtataccgccacaggatgtggctgtcgactggaaccaagttattttcaagggc
ttggtaataaaaggtatttacggccgtgaaatgtttgaaacctggtacaaaatggcgagt
ttgctgcaaagcggtttagacctgtcgcctatcatcacacataccttttctattgatgac
tttcagaaagggtttgataccatggggtcaggacactcaggtaaagttattctggactgg
caataa

DBGET integrated database retrieval system