KEGG   Alteromonas mediterranea U4: I607_04645Help
Entry
I607_04645        CDS       T02720                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00061  Fatty acid biosynthesis
amal00780  Biotin metabolism
amal01100  Metabolic pathways
amal01212  Fatty acid metabolism
Module
amal_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    I607_04645 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    I607_04645 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amal01004]
    I607_04645 (fabZ)
Enzymes [BR:amal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     I607_04645 (fabZ)
Lipid biosynthesis proteins [BR:amal01004]
 Fatty acid synthase
  Component type
   I607_04645 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AGP84737
LinkDB All DBs
Position
1037900..1038349
Genome map
AA seq 149 aa AA seqDB search
MANSLNTIEIQEILELLPHRYPFLLVDRVTDYVLGESVKAYKNITINEPCFMGHFPGQPI
FPGVLILEAMAQAAGVLGFKTMGNNDKLYLYAGIDNARFKRPVVPGDKLEFDVALVKERR
GIWKFKGTASVDGDVACCAEFMCAMREIA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggccaattcactcaataccatcgaaattcaagaaattttggagttacttccacatagg
tatccattcctacttgttgatcgtgtaacagactatgttctgggtgagtctgtaaaggct
tataaaaatattaccattaatgagccttgttttatggggcatttccccggacaacccata
tttcccggcgtactaatcttagaagccatggcacaagctgcaggtgttttaggatttaag
accatggggaataatgataagttatacttatatgcgggaattgataacgcgcgcttcaag
cgtccggttgttcctggagacaagcttgagtttgatgttgctctagttaaagagcgcaga
gggatctggaaatttaaaggtactgcaagtgtcgatggcgacgtcgcgtgctgtgcagag
tttatgtgtgcgatgagagagatagcgtaa

DBGET integrated database retrieval system