KEGG   Alteromonas mediterranea U4: I607_15370Help
Entry
I607_15370        CDS       T02720                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amal  Alteromonas mediterranea U4
Pathway
amal00052  Galactose metabolism
amal00511  Other glycan degradation
amal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I607_15370
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    I607_15370
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    I607_15370
Enzymes [BR:amal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I607_15370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1
Motif
Other DBs
NCBI-ProteinID: AGP86859
LinkDB All DBs
Position
3446397..3449114
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTLLLLATNVTAKQREKIDFTGEWRFYRYADNQTPDSLIYDTRPNVNQ
FDDSQAADTRPSDAVTVNSHDGVLKSWILPTGNAFIANPDKRHVRPEGEPGKDFPFVQRA
FDDSHWKVVNLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLAKDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWFEKTAQIHISQWGTQVITPTVSKDKATISITTSIRNHTKNDQNVSLQHHIY
ELSKQDTLSENPVLTLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEEGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFENTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WSGREGEITPVHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEMVTYKN
GKRWATDSVTTSGVPSGLRLSADRNIINADGKDLSFVTVDIVDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFSGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattaggaattataagggactacttgcccttaccttgctactgttagccaca
aatgttacagccaagcaacgagaaaaaattgattttactggagaatggcgattttaccgc
tacgccgataatcaaacgcctgatagcttgatttacgatactcgccccaacgttaaccag
tttgacgacagccaagcggcggatactcgcccttccgatgcggtaacagttaatagccac
gatggcgtattaaaatcctggattcttcccacgggaaatgcgtttattgctaaccccgat
aagcgccatgtaagacccgaaggcgaaccaggcaaagattttccatttgttcagagagcg
ttcgatgacagccattggaaagtggttaatttacctcacgactgggccatcgcagggcca
ttctatagtggcaacaatcctaaagtggggggcggtatgggacgtctaccctcccacgga
gtagcgtggtatagaaagcagtttacgcttgctaaagacgataaaaacaaacgtatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggctaaatggtcatcttgtcggg
ggttggccttatggttatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggtggcggtatctatcgaaatgtatggtttgaaaaaaccgcacagatccatatcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccacgatatcgattacc
acatcaatcagaaatcatacgaaaaatgatcagaacgtgagtcttcaacaccatatttat
gagctttcaaagcaagatacccttagcgaaaatccggtattaacgcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagctacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaacggaaaaacacttgaccaatacaccacgcccttcggcgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggctgcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacattaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagaaggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccctacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgaatttgaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgcgccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcg
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctgggcagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccggcatgatcgatctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcatattcttccccattggaat
tggtccggtagagagggagaaatcactcctgttcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcacaagggaagaaaaagaaaggtccctttgaatatcga
cttcgctttgatgatgttcgctacacgccgggaacagtagaaatggttacctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgtcccctcaggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcgtagataaaaagggtaatccagtacccactgcgactcaccgcgttcacttttcgctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgagaggaaggcgtttagtggaaagctacttgttatcattcaaagtgaacac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system