KEGG   Acidianus manzaensis: B6F84_02315Help
Entry
B6F84_02315       CDS       T04836                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
aman  Acidianus manzaensis
Pathway
aman00790  Folate biosynthesis
aman01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aman00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B6F84_02315
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aman04147]
    B6F84_02315
Enzymes [BR:aman01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B6F84_02315
Exosome [BR:aman04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B6F84_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ARM74976
UniProt: A0A1W6JXH5
LinkDB All DBs
Position
516268..516561
Genome map
AA seq 97 aa AA seqDB search
MKKLSENEITERLSKLNNWKYENNKIIKEFKFSNFDDSVSFLKLIQPVADGLDHHPDVCV
YYNRVIIELTTHDVGGISDLDFQLAEKIDELSTHVKS
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttcagaaaacgaaataacagagagactttctaagctaaataactggaaa
tatgaaaacaataaaattataaaagaatttaaattttctaatttcgatgattcagtaagc
ttcctaaagttaatacagccagtagcagatggattagaccatcatccagacgtatgtgta
tattacaatagagtaattattgaactaactactcacgatgtaggtggaatatctgattta
gactttcaattagcagaaaagattgatgaactatcgacgcacgttaagtcataa

DBGET integrated database retrieval system