KEGG   Acidianus manzaensis: B6F84_08045Help
Entry
B6F84_08045       CDS       T04836                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aman  Acidianus manzaensis
Pathway
aman03030  DNA replication
aman03410  Base excision repair
aman03420  Nucleotide excision repair
aman03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aman00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    B6F84_08045
   03410 Base excision repair
    B6F84_08045
   03420 Nucleotide excision repair
    B6F84_08045
   03430 Mismatch repair
    B6F84_08045
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aman03032]
    B6F84_08045
   03400 DNA repair and recombination proteins [BR:aman03400]
    B6F84_08045
Enzymes [BR:aman01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B6F84_08045
    6.5.1.6  DNA ligase (ATP or NAD+)
     B6F84_08045
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     B6F84_08045
DNA replication proteins [BR:aman03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    B6F84_08045
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     B6F84_08045
DNA repair and recombination proteins [BR:aman03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     B6F84_08045
   NER (nucleotide excision repair)
    Other NER factors
     B6F84_08045
   MMR (mismatch excision repair)
    Other MMR factors
     B6F84_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ARM75981
UniProt: A0A1W6K083
LinkDB All DBs
Position
1618625..1620424
Genome map
AA seq 599 aa AA seqDB search
MEFKVIAEYFDRLEKISSRIQLTSLLSDLFKNTDKDVIDKVVYLIQGKLWPDFLGMPELG
IGDKFLIKALSIATGVNEDEIDKLFKNIGDLGEVAFEIKQRQQGSNILSFLGAQKSTTLT
VEEAYEDLTKIATSTGERSRDIKIRLLAGLLKKASPLEAKYLVRFIDGRLRVGIGDATVL
DALSITFAGGQNFRPYVERAYNLRADLGNIARILAFEGIEKIKNIKPEPGIPIRPMLAER
LSDPAEILDKVGKTGLVDYKYDGERGQIHKHGDKIFIFSRRLENITSQYPDVAEYVSKFV
NGSEFIIEGEIIPVDPDTGEMRPFQELMHRKRKNDIHEAIKDYPVNVMLFDIMYYEGEDY
TVKPLPERRKKLESIITDNDKVHIADHIITDDVNKLKEFFYQAISDGAEGVMVKSLAPDS
IYQAGSRGWLWIKFKRDYQSEMADTVDLVLVGAFYGKGKKGGKFSSFLMGAYNPDKDVFE
TVCKVASGFSDAELDELQKKIAELRRNEPHPRVVSSMVPDVWLTPSLVAEIIGAEITISP
LHTCCKDQYAIGGLSVRFPRFIRWRPDKSPEDATTNTEILEMYKNQLKKIEENPTDKGT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaagttatagcagaatactttgacagattggaaaaaatatcatctaggatt
cagttaacctctcttttatctgatttatttaaaaatactgataaggatgttatagataag
gttgtctatcttattcagggtaagttatggccagactttttaggcatgccagagttaggt
attggagacaaattcttaattaaggcattgtcaatagctacgggagttaatgaagatgaa
atagataaattatttaaaaacataggtgatcttggcgaggtagcatttgaaattaagcag
agacaacaaggttctaatattttaagttttcttggtgcacaaaaaagcactacactaact
gttgaagaggcttatgaggatttaactaaaatagcaacgtctactggagagagaagtaga
gatataaagataagattattagctggattattaaagaaagcttcacctttggaagctaaa
tatcttgtaagatttatcgatggacggcttagagtaggaataggagatgctacggtatta
gatgcattatctattacttttgcgggaggacagaattttagaccttatgtagaaagagca
tacaatttaagagctgatttaggtaatatagcgagaattctagcttttgaaggaatagaa
aaaataaagaacataaaacctgagcctggtattccaattagaccaatgctagctgaaaga
ctttcagatcctgcggaaattttagataaggtaggtaaaacaggattagtagactataag
tatgatggagaaagaggtcagattcataaacatggagataagatctttattttttctaga
agattagaaaatatcacatctcagtatccagatgtagcagaatatgtatctaaatttgta
aatggttcagagtttataatagaaggagaaatcataccagttgatccagatacaggggag
atgaggccttttcaagaattaatgcatagaaagagaaaaaacgatattcatgaggcaatt
aaagattatccagtaaacgttatgctatttgacattatgtattatgaaggtgaagattat
acagtaaagccattaccagaaagaaggaaaaaattagaatcgataataactgacaatgat
aaggttcatatagcagatcatataattactgacgatgtaaataaactaaaggaattcttt
tatcaagcaatttctgatggagcagaaggtgttatggtaaaatctctagctccagattct
atatatcaagctggatctagaggttggttatggataaaatttaagagagattaccaaagc
gaaatggcagatacagttgatttagtattagtaggagcattttatggtaaaggtaaaaaa
ggtggaaaatttagctcatttttaatgggagcatacaaccctgacaaagatgtattcgaa
accgtgtgtaaagtggcctctggctttagcgatgcagaattagatgaattacaaaagaag
attgcagagctaagaagaaacgaaccacatcctagagtagtttcaagtatggtacctgat
gtatggttaactccatcattagtagcggaaataataggagctgagataactatatctcct
ttacatacatgctgtaaggatcaatatgctataggcggattatcagtgagatttccaaga
tttataagatggaggccagataaaagtccagaagatgctactacaaatactgagatttta
gaaatgtataagaatcaactaaagaagatcgaagaaaatcctacagataaaggaacataa

DBGET integrated database retrieval system