KEGG   Alteromonas mediterranea U8: I634_00435Help
Entry
I634_00435        CDS       T02722                                 

Definition
(GenBank) cysteine transport (export) protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
amao  Alteromonas mediterranea U8
Pathway
amao02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:amao00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I634_00435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:amao02000]
    I634_00435
Transporters [BR:amao02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    I634_00435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 AAA_22 SAYSvFN Sigma54_activat AAA_16 Mg_chelatase AAA_5 AAA_23 SbcCD_C AAA_24 DUF87 AAA_7 ATP-grasp_5 RsgA_GTPase AAA_10
Motif
Other DBs
NCBI-ProteinID: AGP91837
LinkDB All DBs
Position
complement(90955..92619)
Genome map
AA seq 554 aa AA seqDB search
MKFWFSIIFKNERKRLLIGLFWSFFTMLSGVGLLALSGWLITATALAGIAIGAGLIVKLD
MYMPGSGIRYFALSRTIGRYIERLYNHDTILRLIATYRVTIFNALSRRPLHDVRQTSDSE
WLSRLTSDLDALDSILIRYTIPTLATGLLLGVVSLFLCFIWFEFGVVFIIASTLAWLLLI
LFSIRQTKSAASQAISHLNHTRETLISHLKGAFVLNSQHLMSHHSGDTTRALSLFEQHHN
NLQKRIARIQVVTDSIFAIALVATLYASLWAVNHHIIEGPTAIMLALLFVGVAELLQTTP
EQFSTWGKTDYASKRLSTLASESNVSNNTDIAAISEVRCTVSNHPHIPASALRNISFNLI
DTTPFLITGRSGSGKSTLAKLMFKLVPLDKSNASVMINNISVQNISSDSLYRHCAYLEQT
SSLLSGSLYYNLTLGLESIEDSRVFDVLSLVELQAWADSLPEGLNTWLGEGGAKVSGGQA
RRICLARLLLRNPELIVLDEPFNGLDSAMAERIFMRILPWLTARKSIVLLHEVPLFIEQQ
SIDYHSLNVDLSAA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttggttttcaattatctttaagaatgagcgtaaacgcctgctaattgggctc
ttttggtcgttttttaccatgctttctggcgtggggttactggcgctttccggttggctc
attactgccacggcgttagctggaatagccataggtgcgggtttaattgtaaagcttgat
atgtatatgccgggctctgggatccgctattttgcccttagtcggaccattggccgatat
attgaaagactatacaatcacgatactattctgaggctaattgcgacatatcgcgtcacg
atatttaatgcgctctcccgtaggcctcttcacgatgtaaggcaaacgtctgacagcgag
tggctaagccggctcacatcagacttagatgcccttgatagcatattaattcgttacacc
attccaactctagccacagggcttcttttaggtgtggtaagcctttttttgtgcttcata
tggtttgagtttggtgttgtttttataattgcttcaacgctagcctggttacttcttata
ctgttttcaatacggcaaactaaaagcgccgcctcgcaagccatttcgcacttaaatcac
acgagagaaaccttgattagccatcttaagggcgcatttgtgctcaatagccagcatttg
atgagtcatcattcaggtgacactacgagagcactctcgctatttgaacaacatcacaat
aatctgcaaaaacgtattgctcgaattcaggtggtaaccgattcaatatttgctattgcc
cttgtagctacgctttatgccagcctatgggctgtaaaccaccacattattgaggggcca
acagctatcatgttggcacttttgtttgtcggtgtagctgagcttttacaaaccacacca
gaacagttcagtacatggggaaaaaccgactatgcaagtaagcgcctatcaacgttggcc
agtgaaagcaatgtaagtaataacactgatatcgcggcgataagcgaagtgcgttgcacg
gtaagtaatcacccacatattcccgcgagtgcgttacgcaacataagctttaatctgatt
gatacgaccccttttttaatcacaggccgctctggttctggcaagtcaaccttggccaag
cttatgttcaagcttgtaccgttagataaatcgaacgctagcgtaatgataaataatata
tctgtacaaaatatttcgtcagacagcttgtatcgccactgtgcctatctagagcaaacc
tcttcattactgtctggcagtttgtactacaacttaacattgggtcttgaaagcatagaa
gacagtagagtgttcgatgtactttcgctagtagagctacaagcgtgggctgattcgctt
cccgagggattgaatacctggttaggtgaaggtggagcaaaggtctcaggtggacaagca
agacgcatttgtttggctaggttattacttagaaacccagagcttattgtattagatgag
ccgtttaatggcctagatagcgctatggcagagcgtattttcatgcgtatattgccttgg
cttacggcacgaaaatctattgttttacttcatgaagtgcccttgtttatcgagcagcaa
agtattgattaccattcacttaatgtggatttatcagcagcgtaa

DBGET integrated database retrieval system