KEGG   Alteromonas mediterranea U8: I634_06505Help
Entry
I634_06505        CDS       T02722                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amao01100  Metabolic pathways
amao01110  Biosynthesis of secondary metabolites
amao01130  Biosynthesis of antibiotics
amao01230  Biosynthesis of amino acids
amao02024  Quorum sensing
Module
amao_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    I634_06505
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    I634_06505
Enzymes [BR:amao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     I634_06505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AGP93025
LinkDB All DBs
Position
1487766..1488854
Genome map
AA seq 362 aa AA seqDB search
MIKDTVNNVHVSTEDVLITPEALSAELPVSDKALAAISDSRKIVSDIIHRRDHRMLVVCG
PCSIHDVEAAKEYALKLKELHESCKDTLFLVMRVYFEKPRTTTGWKGLINDPHIDGTFDI
ETGLRKARELLIWLAELELPVATEALDPISPQYLAELFSWAAIGARTSESQTHREMASGL
SMPVGFKNGTDGSLDIAINALKSAASGHRFMGINKQGQVSIIGTSGNPDGHIILRGGKQP
NYDSVCVSECEIELQDAGLTAGLVVDCSHANSSKDYRRQPLVAQNVVNQILEGNQSIIGV
MLESHLKPGNQKAEGKKPEELEYGVSITDGCIDWQTTENLITQTRDKLITVLPLRQNKRT
VA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggacaccgtaaataatgttcacgtaagtacagaagatgtacttattacccca
gaagcgttaagcgctgaactgcctgtttcagacaaagcgctcgccgccatttctgattct
agaaaaatcgtttcagatattattcatcgccgcgaccatagaatgctagttgtgtgtggt
ccatgctccattcacgatgtagaagctgcgaaagaatacgcgcttaagctgaaagaactt
cacgagtcatgcaaagatacactctttcttgtaatgcgcgtttattttgaaaaaccgcgc
actactacaggttggaaaggcctaataaatgacccccacatcgacggcacgtttgatatt
gaaacgggcttacgtaaagcaagagaactactgatttggctagcagagctagagctgcct
gttgcaaccgaggcgctagacccaattagcccacagtatctggcagagttatttagctgg
gcggctatcggagcgcgtacatctgaatctcaaactcaccgtgaaatggcaagtggtctt
tctatgccagtgggtttcaaaaatggtacagatggaagtttagatattgcgattaatgcc
cttaaatcggccgcatctggccatcgctttatgggtattaataagcaaggtcaggtaagc
attattgggaccagcggtaacccagacggccatattatccttcgtggtggtaagcagcct
aactatgactctgtgtgcgtgtctgagtgcgaaattgaactacaagatgcgggcctaacc
gcgggcttggttgttgattgcagtcatgctaactcgtctaaagattatcgccgtcagccg
ttagttgcgcaaaacgtggtgaaccaaattcttgaaggcaatcagtctatcattggcgtt
atgctagaaagccacttaaagcctggtaatcaaaaagcagaaggcaaaaagcctgaagaa
ctagaatacggggtttcgattacagatggttgtatcgactggcaaaccacagaaaactta
attactcaaaccagagataaattaataactgtgctacccttacgtcaaaataagcgcacg
gtggcttaa

DBGET integrated database retrieval system