KEGG   Alteromonas mediterranea U8: I634_08440Help
Entry
I634_08440        CDS       T02722                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amao  Alteromonas mediterranea U8
Brite
KEGG Orthology (KO) [BR:amao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amao01002]
    I634_08440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amao04147]
    I634_08440
   04090 CD molecules [BR:amao04090]
    I634_08440
Enzymes [BR:amao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     I634_08440
Peptidases [BR:amao01002]
 Metallo Peptidases
  Family M2
   I634_08440
Exosome [BR:amao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I634_08440
CD molecules [BR:amao04090]
 Proteins
  I634_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Phage-MuB_C
Motif
Other DBs
NCBI-ProteinID: AGP93403
LinkDB All DBs
Position
complement(1927216..1929036)
Genome map
AA seq 606 aa AA seqDB search
MLNHKRTLIAALVSLSLIGCGESTTQTETQAALTAKDAKQFLQQAQDDIAKMQVPAAHAE
WSYATNINFDTAAVSAYFNEVLSTKVAKLAKEAAKFNDVDVDSDTRRQLDLLKNGLTMPP
PADAAKAERLAKIGSDLSAMYGSGEYCSEDGTCKSLVEMSSEMATLRDADKLLEYWAGWR
EISKPMAPLYAEQVELANEGAAELGFENVSALWRGKYDMPADEFPKELDRLWTQVEPFYE
SLHCHVRAKLGEHYGENVVPQDKPIPAHLLGNMWAQSWGNIYDIVKPQQEMQVPDVTAAL
AEQGYDEIAMVKQAESFFSSLGFEELPDTFWERSMFQKPEGRDVQCHASAWDLDDKDDLR
IKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKYL
KQIDLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMSGEVTPDQYNDLWWEL
REKYQGVMAPVERSANAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPLN
RCSIYGSKEAGKALNEMLEMGMSQPWQNALETLTGSPQMDASTIADYFAPLKTWLDKQNA
TRQCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcataaacgtactctgatagcagcactggtaagcctatcgcttataggatgt
ggcgaaagtactacgcagacagaaacccaagcggcactgaccgcaaaagacgcaaaacag
ttcctccagcaagcacaagatgatattgcgaagatgcaggtacccgctgcgcacgcagaa
tggagctatgcgaccaatatcaatttcgataccgctgcggtaagcgcctactttaatgaa
gtgctatcaacaaaagtagcaaagttagccaaagaagcggccaaatttaatgatgtagat
gtggacagtgatacccgcagacaactcgatttattaaaaaatggcttaaccatgccacca
cctgcagatgcagctaaagctgagcgcttagccaagattggctcagacctaagtgccatg
tacggctcgggtgagtattgtagcgaagatgggacgtgcaaaagcttagtagaaatgagc
agtgaaatggccacccttcgtgacgccgataaattattagaatattgggcaggctggcgc
gaaatatctaaaccaatggcaccgctttacgcagaacaagtggagctggcaaatgaaggc
gcggcagagctgggttttgaaaatgtgagtgcactgtggcgcggcaaatatgatatgcct
gctgatgagtttcccaaagagctagaccgcttgtggacgcaagtagaacctttttatgaa
tcacttcattgtcatgtacgcgcaaagcttggtgaacattacggtgaaaatgtagtacct
caagacaaacccattccggcccaccttttaggcaatatgtgggcacagtcgtggggtaac
atttacgatatcgtaaaacctcaacaagaaatgcaggtaccagatgtaaccgctgcgttg
gctgaacaaggctatgacgaaatcgctatggttaaacaggctgaatcatttttctcatcc
ctaggctttgaggaactgccagatacgttctgggaacgctctatgtttcaaaaaccagaa
ggccgtgacgtacaatgccatgcttctgcgtgggatttagatgacaaagacgaccttcgc
ataaaaatgtgtattcaaaagacaggcgaagagttcaacgttattcaccatgaattaggt
cacaactattatcagcgcgcctataaagatcagccactgctctatcgcggttcagctaac
gacggtttccatgaagcgattggcgacactatcgcactatcaattacgcctaaatacctt
aaacaaattgatttgattgatgaaatcccagatgcgtcgaatgatatcggcatgttgatg
caggtagcgcttgataagatcgcgtttattccttttggtttaatggttgaccaatggcgt
tggaaggtgatgtcgggggaagtaacacctgaccaatacaatgacctgtggtgggagctt
cgagagaagtatcaaggtgtgatggcacctgtcgagcgaagtgcaaatgcctttgaccca
ggtgcaaagtatcatgtaccagcaaatgtaccctacacgcgctatttcctagcgcacatc
cttcaattccagttccacaaagccttgtgtgatatagctggtgatgaaggcccgctaaat
cgctgctctatttacggcagtaaagaagccggtaaggcactaaacgagatgctggaaatg
ggcatgagtcaaccgtggcagaacgcgttagagacactaacgggctcgccgcaaatggat
gctagcaccattgctgattacttcgcgccgctcaaaacgtggttagataagcaaaatgcg
acacgccagtgcggttggtag

DBGET integrated database retrieval system