KEGG   Alteromonas mediterranea U8: I634_09010Help
Entry
I634_09010        CDS       T02722                                 

Definition
(GenBank) cell elongation-specific transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
amao  Alteromonas mediterranea U8
Pathway
amao00550  Peptidoglycan biosynthesis
amao01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:amao00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I634_09010
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    I634_09010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:amao01011]
    I634_09010
Enzymes [BR:amao01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     I634_09010
Peptidoglycan biosynthesis and degradation proteins [BR:amao01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   I634_09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGP93517
LinkDB All DBs
Position
complement(2057229..2059142)
Genome map
AA seq 637 aa AA seqDB search
MHRKRQAIRDHSAEANLFARRATIAFIIVIAMLGIVLNNLYSLQVTQFEDYQTRSNGNRI
KVLPIAPNRGLIYDRNGVLLAENRPVFSLEVIPEQVDDIDATLLELTELMGITNDELERF
QSTLKGTRRFKPVALRTQLSEEEVALFSASKHKFPGVQIEARLARHYPYKETLTHALGYV
ARINKRDLQKLVEAGQEDNYAATHDIGKLGIEKYHEELLHGKVGYQQVEVNNQGRIIRVL
SVEPPTPGKDIVLNLDLKLQLEAQRIIDGMRGAIVVTDVKTGGVLALYSNPSYDPNLFVH
GISSKNYSALLNSPDRPLINRATQGQYPPASTIKPHLGLVGLEEGVITKDYTITDTGRYK
LPNVSHVWRDWRRWGHGKVDVSKAIEVSCDTYYYELAYKLGIDKISDAMYKFGFGDFTGI
DLYEESDANMPSRGWKRARFNQPWYIGDTIPVGIGQSYWTTTPVQLNTSVNTLINAGERY
IPQIIRGYMKTDSSVDLIPLKSLRPIEIKNRDNLDVVLNAMRDVVSGEEGGARHAFADTP
YDSAGKTGTAQLFTVGQNEKYDASKIDERLRDNAMYVGFAPFDDPEISVTVVLENVGGGS
KNAAPVARQIMDFYFKDRVFETANTAQSNNTNKLGAN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgaaaacgtcaagcgatacgcgaccattcagccgaagcgaacttgttcgctcgt
cgggcgacgattgcttttatcattgttatagccatgttgggcattgtgctaaacaacctt
tattctttgcaggttactcagtttgaagattatcagacccgttctaacggtaaccgaatt
aaagtgctgccgatagcgcccaaccgcgggcttatctacgatcgtaacggtgtgctttta
gcagaaaatcgccccgtttttagtttggaagtcattccggaacaggtcgatgatattgat
gccacccttctggaactgactgaactgatgggtattactaacgatgaacttgaacgcttt
cagtcaacgcttaaaggtacccgccgatttaaaccggtagcacttcgtacacagcttagc
gaagaggaagttgcgctattttccgccagcaaacataagtttcccggcgtacaaattgag
gctcgtctggcccgtcattacccctacaaagaaacccttacgcatgcccttggttacgtt
gcccgaattaataaacgagacttacaaaagcttgttgaggcgggccaagaagataactat
gcggctacgcatgacattggtaagttgggtattgaaaaatatcatgaagaactcctgcac
ggaaaggttggttaccaacaggtggaggtcaacaatcaaggccgaattattcgcgttctt
agtgttgaaccgccaacgccaggcaaagacatcgtacttaatttagatctaaaacttcag
ctagaagcccagcgcattatcgatggcatgcgtggagcaattgttgttaccgacgtgaaa
accggtggagtgctggcactttattcaaaccccagttacgaccccaacttgtttgttcac
ggcattagcagtaagaactattcagcactgttaaattctcccgaccgcccgcttattaat
cgagcgacccaggggcaatacccgccagcgtcgacgattaagccccacctaggcttagta
ggcttagaagaaggtgtgatcacgaaagactacaccattactgatacgggccgttataaa
ctgccaaacgtatcacacgtgtggcgtgattggcgtcgctggggtcatggcaaagttgat
gtttctaaagcgatagaggtgtcctgcgatacctattattacgagttagcctataaactg
ggtatcgataaaataagcgacgccatgtataaatttgggttcggtgattttaccggcatc
gacttatatgaagaatctgatgccaatatgcctagccgtggctggaagcgcgctcgattt
aatcagccttggtatataggcgataccattccggtaggcattggtcaaagctattggacc
accactcctgtgcagctcaatacctcagtgaatacgctgataaacgcgggggaacgctac
attccgcaaattattcgcggctatatgaaaacggatagctcggtagacctcattcccctt
aaatcgttacgtcctatcgaaattaaaaatcgcgacaacttagatgttgtattgaacgcg
atgcgcgatgttgttagcggtgaagaaggcggcgctaggcatgcctttgccgatactcct
tacgattcagcgggtaaaacaggaacggctcagctgtttactgtaggacaaaatgaaaag
tatgatgccagcaaaatagatgagcgccttcgcgataacgccatgtatgttggctttgca
cctttcgatgacccggaaatttcggtaacagtagtgctagagaacgtgggaggcggaagt
aaaaatgctgcgcccgtagcccgtcaaattatggacttttacttcaaagatcgggtgttc
gaaaccgccaatacagcacaatcaaacaataccaataagttaggggcgaattag

DBGET integrated database retrieval system