KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_01960Help
Entry
AMBAS45_01960     CDS       T02253                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01130  Biosynthesis of antibiotics
amb01230  Biosynthesis of amino acids
Module
amb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:amb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBAS45_01960 (aroK)
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AMBAS45_01960 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 Cytidylate_kin AAA_33 AAA_16 AAA_24 AAA_25 dNK ABC_tran AAA_22 AAA APS_kinase TsaE Ploopntkinase3 Guanylate_kin AAA_29 RNA_helicase AAA_5 AAA_7 AAA_17 AAA_28 RsgA_GTPase AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AFT93874
UniProt: K0EC50
LinkDB All DBs
Position
complement(451006..451521)
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLADELHLDFFDSDQEIERRTGADIAWIFDLEGEDGFR
KREENVINDLTDKQGIVLATGGGSIVTKAVRNRLSARGIVVYLQTTIDKQVARTQRDKRR
PLLQNEDPEQVLRDLAEMRNPLYEEVADYIVDTDDQSARAVANQIISKIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgtaatatctttttagttggcccaatgggtgctggcaaaagtaccatc
ggtagacatctggcagacgaacttcacctagacttttttgattcggatcaggaaattgag
cgccgcacgggtgcagacattgcctggatcttcgaccttgaaggcgaagacggtttccgt
aaacgcgaagaaaacgtcattaacgatttgacagataagcaaggtattgtacttgctact
ggcggcggttctattgtaactaaagctgtgcgtaatcgtttatctgcccgcggcatcgtt
gtttacctacaaacgacaatcgataagcaagttgcccgtacacaacgtgacaaacgtcgt
cctttgctacaaaacgaagatccagaacaagtacttcgcgatcttgcagaaatgcgcaac
ccgctttacgaagaagttgctgattacattgttgatacagacgaccaaagtgcgcgtgct
gtagcgaatcagattatcagtaaaattggtttataa

DBGET integrated database retrieval system