KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_08785Help
Entry
AMBAS45_08785     CDS       T02253                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Brite
KEGG Orthology (KO) [BR:amb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMBAS45_08785
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMBAS45_08785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA DAO Lycopene_cycl FAD_oxidored Thi4 AlaDh_PNT_C Thioredoxin_9 ABC_transp_aux NAD_binding_8 Glutaredoxin Thioredoxin_4 K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFT95228
UniProt: K0EF49
LinkDB All DBs
Position
2079080..2080669
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKSYAESMQKNVTFVVQTGEHSKREELVTFLSDIASVSEKLNVEERDTNGE
LRSAISFLLEADGEDTGIRFSGIPGGHEFNSLVLAMLHAAGTELKLDDSVKSMVKAVNEP
LNFEVFISLSCHNCPEVVQALNQFALINPNIKTEMIDGGLYQNLIQERDIQGVPSVYLNG
ELFANGKVDASVLINKLIERDPSLKEANKGDALPLQDVTVIGGGPAGVASAIYSTRKGLK
VAIVAETFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVRDYDITLKEHVRVDSIEKGN
IKTITLSSGEQIRTRTVIVATGARWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADKVLIDQAQKRDNITIIKNAATRQITAEN
GKVNAIEYQDRSTNEVHTRELAGVFVQIGLVPNSQFMKGTVDMTQYGEIIVDTKCHTSEP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVVESEQESEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcattgaaatcatatgcagagtcaatgcaaaaaaac
gtaacctttgtcgtacagaccggtgaacatagcaagcgtgaagagcttgtgacgtttctg
tccgacattgcttcagtaagcgaaaaattaaacgtagaagagcgtgacactaatggtgag
ttgcgcagtgcaatcagctttttattggaagctgacggcgaagatacgggaattcgtttt
tctggtatccctggcggtcacgagtttaactcgcttgtacttgccatgctgcacgcagcg
ggtactgaacttaagctagatgatagcgttaagtcgatggtgaaagcggtgaatgaacca
cttaattttgaagtgttcattagcttaagctgtcacaactgccctgaagtcgtacaggca
cttaatcaattcgcattgattaatcctaacatcaagaccgaaatgatcgacggcgggtta
tatcaaaatctaattcaagagcgcgacatccaaggtgttcctagcgtataccttaatggc
gagctattcgcgaatggtaaagttgatgcctctgtgcttatcaacaagttaattgaacgc
gaccctagccttaaagaagcaaacaaaggcgatgcgttaccacttcaagacgtaacggtt
atcggtggtggcccagcaggtgttgcttcggcaatttacagtacccgtaaaggccttaaa
gttgccattgttgctgaaacttttggcggccaagttaaagataccatgggtatcgagaac
cttatctctgtacctaaaacaacgggccctgagcttgttggtaatttgatggagcacgta
cgcgattacgacattacgcttaaagagcacgtgcgcgttgatagcattgagaaaggcaat
attaaaaccattacgctttcttctggcgaacagatccgcactcgtacggttattgttgcg
acaggcgcacgctggagagagcttggtgttccgggcgaaaaagagaacatcggtaatggt
gttgcgtactgcccacactgcgacggccctttcttcaaaggtaaagacgtagcggtcatt
ggcggtggtaactcaggtattgaagcggcacttgaccttgcaggcattgtaaaatcggtg
acggtatttgaatttatgccagaactgaaagcggataaggtacttatcgatcaagctcaa
aaacgcgataatattaccattatcaagaacgcggcaacgcgccaaattactgctgaaaat
ggcaaagtgaacgcaattgaataccaagatcgctcaactaacgaagtgcacactcgtgaa
cttgcaggtgtatttgttcaaattggactagtaccaaacagtcagtttatgaagggcacg
gtagacatgacgcagtatggcgaaattattgttgatactaagtgtcatacatctgagcct
ggtatatttgcagccggtgacgtaacaacagtaccgtataagcaaattgttatttcgatg
ggtgagggcgcgaaagcatcgcttgctgcatttgaatacttattgagccatgaagtggtt
gagtctgaacaggaaagtgaagcggcatag

DBGET integrated database retrieval system