KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_10120Help
Entry
AMBAS45_10120     CDS       T02253                                 

Definition
(GenBank) 3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00061  Fatty acid biosynthesis
amb01100  Metabolic pathways
amb01212  Fatty acid metabolism
Module
amb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMBAS45_10120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amb01004]
    AMBAS45_10120
Enzymes [BR:amb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AMBAS45_10120
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AMBAS45_10120
Lipid biosynthesis proteins [BR:amb01004]
 Fatty acid synthase
  Component type
   AMBAS45_10120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AFT95495
UniProt: K0EJB2
LinkDB All DBs
Position
complement(2398295..2398813)
Genome map
AA seq 172 aa AA seqDB search
MSEKKNSFNKEDLLACSRGEMFGPGNSQLPAPNMLMMDRVVSITEDGGEHGKGEIIAELD
ITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWSGGPGKGRALGVGEVKFTGQILP
TAKKVTYKITMKRVIKRKLFMGMADGSVEVDGREIYVAKDLKVGLFQDTSNF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaagaaaaatagttttaacaaagaagatttattggcgtgtagccgtggtgaa
atgtttggcccaggtaacagtcaacttcccgcacctaacatgttaatgatggaccgtgta
gtttcaattacggaagatggcggtgagcatgggaaaggcgaaattatcgctgagttagat
attacccccgatttatggttttttgattgtcacttcccaggtgatccggtaatgccggga
tgcctaggcctagacgcgatgtggcagttagttggtttcttcttaggttggagcggcggc
cctggtaaaggccgagctttaggtgtaggtgaagttaaatttaccggtcaaatccttcca
accgctaagaaggtaacgtataagatcacgatgaagcgcgtgataaagcgtaaacttttc
atgggtatggcagatggttcagtagaagttgatggccgtgagatttacgtagcgaaagat
ttgaaagttggcttgttccaagatacctcaaacttctaa

DBGET integrated database retrieval system